BLASTX nr result
ID: Anemarrhena21_contig00056746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00056746 (306 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009390789.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 >ref|XP_009390789.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Musa acuminata subsp. malaccensis] Length = 592 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = -2 Query: 161 YSTPFFFNTLISGIT*IKNPHSAIVIYKYMVLGGVYPDKYTSPIILKSCAKFW 3 Y P FN+LISG K+PH IV YK M+ V+PD+YT PI+LKSC KF+ Sbjct: 74 YQFPLLFNSLISGYARSKHPHLGIVAYKLMLADSVFPDRYTFPIVLKSCIKFF 126