BLASTX nr result
ID: Anemarrhena21_contig00056733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00056733 (384 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010251440.1| PREDICTED: two-component response regulator-... 57 6e-06 >ref|XP_010251440.1| PREDICTED: two-component response regulator-like PRR95 [Nelumbo nucifera] Length = 702 Score = 56.6 bits (135), Expect = 6e-06 Identities = 37/123 (30%), Positives = 55/123 (44%), Gaps = 1/123 (0%) Frame = -1 Query: 366 VNSFHPSIPKAHNPEKDHHPCDKNVDKSG-YQSGTTQERNSESREDPEHIPSAPAEXXXX 190 +NS S P+ N + +HP +N + + ++ +E N ES E P + A Sbjct: 532 LNSSLHSNPETCNSRQGYHPHSQNENYANKHKVHELEEHNMESAEHPGDVSPATGNSASS 591 Query: 189 XXXXXXXXXXXXXXXXSVCNESNRNISAAATPIATSESGNDECIFTTDQVRSIDCQHVSR 10 S+CN SN N++ AA T+ES DECIF D +R I+ + Sbjct: 592 SLCNGAVSHLNSSGCGSICNGSNGNVTPAAAGRTTTESETDECIFIHDGIRGINSHRSTE 651 Query: 9 REA 1 REA Sbjct: 652 REA 654