BLASTX nr result
ID: Anemarrhena21_contig00056457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00056457 (326 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008793742.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_010931478.1| PREDICTED: pentatricopeptide repeat-containi... 73 9e-11 ref|XP_009388863.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 65 2e-08 ref|XP_010247013.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_012086394.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_010657333.1| PREDICTED: putative pentatricopeptide repeat... 61 3e-07 ref|XP_008230158.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_007216378.1| hypothetical protein PRUPE_ppa020947mg [Prun... 61 3e-07 ref|XP_010681694.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_002515711.1| pentatricopeptide repeat-containing protein,... 58 2e-06 gb|KHN22863.1| Pentatricopeptide repeat-containing protein, chlo... 57 4e-06 ref|XP_003540859.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_009341462.1| PREDICTED: putative pentatricopeptide repeat... 56 8e-06 >ref|XP_008793742.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Phoenix dactylifera] Length = 721 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATMLC 2 LNSLQCG+LL+ +TN KS +KG++LHAHM+SSGVL++NTYL+T LC Sbjct: 43 LNSLQCGHLLQIVTNSKSLEKGRKLHAHMVSSGVLLDNTYLSTKLC 88 >ref|XP_010931478.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Elaeis guineensis] Length = 721 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATMLC 2 LNSLQCG+LL+ ITN KS +KG+ LHAHM++SGVL++NTYL+T LC Sbjct: 43 LNSLQCGHLLQIITNFKSLEKGRRLHAHMVASGVLLDNTYLSTKLC 88 >ref|XP_009388863.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g06140, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 651 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATMLC 2 L SLQCG LL+S+TN +S +G+ LHAHM++SGVL++NTYL+T LC Sbjct: 44 LASLQCGRLLQSLTNSRSLGQGRRLHAHMVASGVLLDNTYLSTKLC 89 >ref|XP_010247013.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Nelumbo nucifera] Length = 642 Score = 64.3 bits (155), Expect = 3e-08 Identities = 34/69 (49%), Positives = 47/69 (68%) Frame = -2 Query: 211 WFRFTFLSSQSLT*MSVKPPHFRTLNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLI 32 + + F ++Q L ++PP L+SLQCG LL+S TN KSY +GK LHA+M++S +L Sbjct: 22 YLQIDFYTTQ-LAGKDLRPP----LSSLQCGALLQSFTNTKSYTEGKRLHAYMITSNILF 76 Query: 31 NNTYLATML 5 NNTYL T L Sbjct: 77 NNTYLNTKL 85 >ref|XP_012086394.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Jatropha curcas] gi|643712640|gb|KDP25879.1| hypothetical protein JCGZ_22909 [Jatropha curcas] Length = 718 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -2 Query: 154 PHFRTLNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 PH + L SLQCG +L+S+TN KS KG++LHA++++SG L NNTYL+T L Sbjct: 35 PH-QPLTSLQCGKILQSVTNTKSLAKGRQLHAYIITSGTLQNNTYLSTKL 83 >ref|XP_010657333.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Vitis vinifera] Length = 723 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 L SLQCG LL+S TN KS+++G++LHAHM+S +L NNTYL T L Sbjct: 44 LTSLQCGALLQSFTNTKSFKQGQQLHAHMISFSILENNTYLNTKL 88 >ref|XP_008230158.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Prunus mume] Length = 643 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 L SLQCG +L+S+TN KS+ KG++LHA M++SG L+NNTYL+T L Sbjct: 31 LTSLQCGKILQSLTNTKSFPKGQKLHALMVTSGNLLNNTYLSTKL 75 >ref|XP_007216378.1| hypothetical protein PRUPE_ppa020947mg [Prunus persica] gi|462412528|gb|EMJ17577.1| hypothetical protein PRUPE_ppa020947mg [Prunus persica] Length = 710 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 L SLQCG +L+S+TN KS+ KG++LHA M++SG L+NNTYL+T L Sbjct: 31 LTSLQCGKILQSLTNTKSFPKGQKLHALMVTSGNLLNNTYLSTKL 75 >ref|XP_010681694.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Beta vulgaris subsp. vulgaris] gi|870856542|gb|KMT08169.1| hypothetical protein BVRB_6g142920 [Beta vulgaris subsp. vulgaris] Length = 559 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 L+SLQCG LL+S+TN + KG+ LHAH++SSGVL+ NT+LA+ L Sbjct: 9 LSSLQCGALLQSLTNSRLLNKGQILHAHIISSGVLLKNTFLASKL 53 >ref|XP_002515711.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545148|gb|EEF46658.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 462 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/45 (55%), Positives = 39/45 (86%) Frame = -2 Query: 139 LNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 L SLQCG +L+++T++KS+ KG++LHA++++SG L NNTYL+T L Sbjct: 39 LTSLQCGTVLQTLTSIKSFTKGQQLHAYIITSGNLQNNTYLSTKL 83 >gb|KHN22863.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 701 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -2 Query: 160 KPPHFRTLNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 KP T +SLQCG LL+S+TN KS + +LHAH+ + G L NTYLAT L Sbjct: 13 KPSSTSTFDSLQCGTLLQSLTNSKSLTQALQLHAHVTTGGTLRRNTYLATKL 64 >ref|XP_003540859.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 701 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -2 Query: 160 KPPHFRTLNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLATML 5 KP T +SLQCG LL+S+TN KS + +LHAH+ + G L NTYLAT L Sbjct: 13 KPSSTSTFDSLQCGTLLQSLTNSKSLTQALQLHAHVTTGGTLRRNTYLATKL 64 >ref|XP_009341462.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Pyrus x bretschneideri] Length = 711 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -2 Query: 190 SSQSLT*MSVKPPHFRTLNSLQCGYLLRSITNLKSYQKGKELHAHMLSSGVLINNTYLAT 11 S+ L +S+ PP SLQCG + +S+T KS+ KG++LHA +++G LINNTYL+T Sbjct: 19 STLHLKHLSLSPP----FTSLQCGTIFQSLTKTKSFPKGQQLHAVCVTAGNLINNTYLST 74 Query: 10 ML 5 L Sbjct: 75 KL 76