BLASTX nr result
ID: Anemarrhena21_contig00056308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00056308 (432 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB45331.1| hypothetical protein B456_007G301700 [Gossypium r... 65 2e-08 gb|KJB41868.1| hypothetical protein B456_007G127300 [Gossypium r... 64 4e-08 gb|KJB23304.1| hypothetical protein B456_004G091200 [Gossypium r... 62 1e-07 ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like ... 62 1e-07 ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelu... 62 1e-07 ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelu... 62 1e-07 ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa... 62 1e-07 ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa... 62 1e-07 ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like ... 62 1e-07 ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like ... 62 1e-07 ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like ... 62 1e-07 gb|ACN41161.1| unknown [Picea sitchensis] 62 1e-07 gb|ABK26318.1| unknown [Picea sitchensis] 62 1e-07 gb|ABK21809.1| unknown [Picea sitchensis] gi|116792950|gb|ABK265... 62 1e-07 ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like ... 61 3e-07 ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elae... 61 3e-07 ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elae... 61 3e-07 gb|KDO39192.1| hypothetical protein CISIN_1g030771mg [Citrus sin... 61 3e-07 ref|XP_006433452.1| hypothetical protein CICLE_v10002597mg [Citr... 61 3e-07 ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045... 60 4e-07 >gb|KJB45331.1| hypothetical protein B456_007G301700 [Gossypium raimondii] Length = 195 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTVTYSTSKFILVC 124 TARARI KAGGECLTFDQLALRAPLGQNTV S FI C Sbjct: 107 TARARIEKAGGECLTFDQLALRAPLGQNTVWGSLVSFIFEC 147 >gb|KJB41868.1| hypothetical protein B456_007G127300 [Gossypium raimondii] Length = 178 Score = 63.9 bits (154), Expect = 4e-08 Identities = 36/54 (66%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV-TYSTSKFILVCRYHGIYIIGCIV 160 TARARI KAGGECLTFDQLALRAPLGQNTV ST F LV + ++G V Sbjct: 107 TARARIEKAGGECLTFDQLALRAPLGQNTVHKSSTYNFFLVVYDNDYQVLGSTV 160 >gb|KJB23304.1| hypothetical protein B456_004G091200 [Gossypium raimondii] Length = 159 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTVTYSTSKFILVC 124 TARARI KAGGECLTFDQLALRAPLGQNTV + F C Sbjct: 107 TARARIDKAGGECLTFDQLALRAPLGQNTVCFIIQIFYFSC 147 >ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. malaccensis] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. malaccensis] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. malaccensis] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. malaccensis] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. malaccensis] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >gb|ACN41161.1| unknown [Picea sitchensis] Length = 134 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 54 TARARILKAGGECLTFDQLALRAPLGQNTV 83 >gb|ABK26318.1| unknown [Picea sitchensis] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >gb|ABK21809.1| unknown [Picea sitchensis] gi|116792950|gb|ABK26564.1| unknown [Picea sitchensis] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis] Length = 187 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARI+KAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARIVKAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis] Length = 187 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARIL+AGGECLTFDQLALRAPLGQNTV Sbjct: 107 TARARILQAGGECLTFDQLALRAPLGQNTV 136 >ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis] Length = 187 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 T RARILKAGGECLTFDQLALRAPLGQNTV Sbjct: 107 TVRARILKAGGECLTFDQLALRAPLGQNTV 136 >gb|KDO39192.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis] Length = 170 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTVTYSTSKFIL 118 TARARI KAGGECLTFDQLALRAPLGQNTV + + L Sbjct: 106 TARARIEKAGGECLTFDQLALRAPLGQNTVCVFNANYCL 144 >ref|XP_006433452.1| hypothetical protein CICLE_v10002597mg [Citrus clementina] gi|557535574|gb|ESR46692.1| hypothetical protein CICLE_v10002597mg [Citrus clementina] gi|641818355|gb|KDO39193.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis] Length = 171 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTVTYSTSKFIL 118 TARARI KAGGECLTFDQLALRAPLGQNTV + + L Sbjct: 107 TARARIEKAGGECLTFDQLALRAPLGQNTVCVFNANYCL 145 >ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis] Length = 398 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 2 TARARILKAGGECLTFDQLALRAPLGQNTV 91 TARARILKAGGECLTFD LALRAPLGQNTV Sbjct: 318 TARARILKAGGECLTFDHLALRAPLGQNTV 347