BLASTX nr result
ID: Anemarrhena21_contig00056164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00056164 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008792694.1| PREDICTED: potassium transporter 1 [Phoenix ... 62 1e-07 >ref|XP_008792694.1| PREDICTED: potassium transporter 1 [Phoenix dactylifera] Length = 761 Score = 62.0 bits (149), Expect = 1e-07 Identities = 34/68 (50%), Positives = 45/68 (66%) Frame = -1 Query: 250 DFGASDDVCIDVPVSVLSAPYLEGNPMSSSCTVLVKLEDYGIAEGSLRKDESLDILKAKD 71 D S+ C D+ V ++ E + +SSS T LVK D+ + EGS KDESL+ILKAK+ Sbjct: 642 DLRVSNPECPDIFVPSVTGQKFEQDLLSSSDTYLVKPGDFRLMEGSFCKDESLEILKAKE 701 Query: 70 SGIVYILG 47 SG+VYILG Sbjct: 702 SGVVYILG 709