BLASTX nr result
ID: Anemarrhena21_contig00055263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00055263 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009416987.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 133 5e-29 ref|XP_008802215.1| PREDICTED: putative pentatricopeptide repeat... 129 8e-28 ref|XP_010937493.1| PREDICTED: putative pentatricopeptide repeat... 125 8e-27 gb|KHN28580.1| Putative pentatricopeptide repeat-containing prot... 117 3e-24 ref|XP_003553304.1| PREDICTED: putative pentatricopeptide repeat... 117 3e-24 ref|XP_003624492.1| Pentatricopeptide repeat-containing protein ... 115 9e-24 ref|XP_007161628.1| hypothetical protein PHAVU_001G085300g [Phas... 115 1e-23 ref|XP_004493071.1| PREDICTED: putative pentatricopeptide repeat... 115 1e-23 gb|KDO43564.1| hypothetical protein CISIN_1g004487mg [Citrus sin... 113 4e-23 ref|XP_006468886.1| PREDICTED: putative pentatricopeptide repeat... 113 4e-23 gb|KHM99218.1| Putative pentatricopeptide repeat-containing prot... 112 7e-23 ref|XP_010660688.1| PREDICTED: putative pentatricopeptide repeat... 112 1e-22 emb|CBI21281.3| unnamed protein product [Vitis vinifera] 112 1e-22 ref|XP_006446942.1| hypothetical protein CICLE_v10014272mg [Citr... 112 1e-22 ref|XP_008450146.1| PREDICTED: putative pentatricopeptide repeat... 112 1e-22 ref|XP_004148020.1| PREDICTED: putative pentatricopeptide repeat... 111 2e-22 ref|NP_186850.1| pentatricopeptide repeat-containing protein [Ar... 111 2e-22 ref|XP_012067344.1| PREDICTED: putative pentatricopeptide repeat... 111 2e-22 ref|XP_008231187.1| PREDICTED: putative pentatricopeptide repeat... 111 2e-22 gb|KDP41851.1| hypothetical protein JCGZ_26869 [Jatropha curcas] 111 2e-22 >ref|XP_009416987.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At2g01510 [Musa acuminata subsp. malaccensis] Length = 815 Score = 133 bits (334), Expect = 5e-29 Identities = 59/85 (69%), Positives = 75/85 (88%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SAC+HSGLV+EGLQ F+SM ELY +KP+K HY+C++DL+GR+GRFDEVE+L+ +MPFE Sbjct: 551 LSACNHSGLVEEGLQYFDSMTELYGLKPRKEHYACIIDLMGRVGRFDEVERLLDQMPFEA 610 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 DQIIWNS+LNS +IH N ELA RAA Sbjct: 611 DQIIWNSILNSCRIHGNQELARRAA 635 >ref|XP_008802215.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Phoenix dactylifera] gi|672164664|ref|XP_008802216.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Phoenix dactylifera] gi|672164666|ref|XP_008802217.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Phoenix dactylifera] Length = 816 Score = 129 bits (324), Expect = 8e-28 Identities = 59/85 (69%), Positives = 72/85 (84%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSHSGL+DEGL+ F SM E Y +KPKK HY+CV+DLLGR+G DEVE+L+ ++PFE Sbjct: 552 LSACSHSGLIDEGLRFFNSMTEYYKLKPKKEHYACVIDLLGRVGCLDEVERLVDQIPFEA 611 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 DQIIWNS+LNS +IHSN ELA RAA Sbjct: 612 DQIIWNSILNSCRIHSNQELARRAA 636 >ref|XP_010937493.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Elaeis guineensis] Length = 757 Score = 125 bits (315), Expect = 8e-27 Identities = 57/85 (67%), Positives = 71/85 (83%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSHSGL+DEGL+ F SM E Y +KPKK HY+CV+DLLGR+G DEVE+L+ ++PFE Sbjct: 552 LSACSHSGLIDEGLRFFNSMTEYYKLKPKKEHYACVIDLLGRVGCLDEVERLVDQIPFEA 611 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 DQIIWNS+L+S +IH N ELA RAA Sbjct: 612 DQIIWNSILSSCRIHKNQELARRAA 636 >gb|KHN28580.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 737 Score = 117 bits (293), Expect = 3e-24 Identities = 52/85 (61%), Positives = 70/85 (82%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 + ACSH GLV+EGLQ F SM ++Y ++P++ HY+ +VD+L R GRFDE EKL+ARMPFEP Sbjct: 472 LCACSHCGLVEEGLQYFNSMTQVYKLEPRREHYASMVDMLCRSGRFDEAEKLMARMPFEP 531 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+S+LNS +IH N ELA +AA Sbjct: 532 DEIMWSSILNSCRIHKNQELAIKAA 556 >ref|XP_003553304.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Glycine max] Length = 815 Score = 117 bits (293), Expect = 3e-24 Identities = 52/85 (61%), Positives = 70/85 (82%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 + ACSH GLV+EGLQ F SM ++Y ++P++ HY+ +VD+L R GRFDE EKL+ARMPFEP Sbjct: 550 LCACSHCGLVEEGLQYFNSMTQVYKLEPRREHYASMVDMLCRSGRFDEAEKLMARMPFEP 609 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+S+LNS +IH N ELA +AA Sbjct: 610 DEIMWSSILNSCRIHKNQELAIKAA 634 >ref|XP_003624492.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1125 Score = 115 bits (289), Expect = 9e-24 Identities = 53/85 (62%), Positives = 67/85 (78%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 + ACSH GLV+EGLQ F+SM +Y + PKK HY+ +D+L R GRFDE EKL+A+MPFEP Sbjct: 609 LCACSHCGLVEEGLQYFDSMTRIYKLVPKKEHYASTIDMLCRGGRFDEAEKLMAQMPFEP 668 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SVLNS IH N ELA +AA Sbjct: 669 DEIMWSSVLNSCGIHKNQELAKKAA 693 >ref|XP_007161628.1| hypothetical protein PHAVU_001G085300g [Phaseolus vulgaris] gi|561035092|gb|ESW33622.1| hypothetical protein PHAVU_001G085300g [Phaseolus vulgaris] Length = 862 Score = 115 bits (288), Expect = 1e-23 Identities = 51/85 (60%), Positives = 66/85 (77%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 + ACSH GLV+EGLQ F SM ++Y PK+ HY+ +VD+L R GRFDE EKL+ARMPFEP Sbjct: 597 LCACSHCGLVEEGLQYFSSMTQVYKFVPKREHYASMVDMLCRSGRFDEAEKLMARMPFEP 656 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+++W S+LNS +IH N E+ RAA Sbjct: 657 DEVMWTSILNSCRIHKNQEMGKRAA 681 >ref|XP_004493071.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Cicer arietinum] Length = 812 Score = 115 bits (288), Expect = 1e-23 Identities = 53/85 (62%), Positives = 67/85 (78%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 + ACSH GLV+EGLQ F SM ++Y + PKK HY+ ++D+L R GRFDE EKL+A+MPFEP Sbjct: 547 LCACSHCGLVEEGLQYFNSMTQIYKLVPKKEHYASIIDMLCRGGRFDEAEKLMAQMPFEP 606 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I W+SVLNS +IH N ELA AA Sbjct: 607 DEITWSSVLNSCRIHKNQELAKIAA 631 >gb|KDO43564.1| hypothetical protein CISIN_1g004487mg [Citrus sinensis] Length = 749 Score = 113 bits (283), Expect = 4e-23 Identities = 51/85 (60%), Positives = 68/85 (80%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSH GL++EGLQ F SM + Y ++PKK HY+ +VD+L R G FDE EKL+A+MPFEP Sbjct: 484 LSACSHCGLIEEGLQYFNSMTQKYKLRPKKEHYASMVDILCRSGCFDEAEKLMAQMPFEP 543 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SV+NS +IH N E A +AA Sbjct: 544 DEIMWSSVINSCRIHKNLEFAKKAA 568 >ref|XP_006468886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Citrus sinensis] Length = 828 Score = 113 bits (283), Expect = 4e-23 Identities = 51/85 (60%), Positives = 68/85 (80%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSH GL++EGLQ F SM + Y ++PKK HY+ +VD+L R G FDE EKL+A+MPFEP Sbjct: 563 LSACSHCGLIEEGLQYFNSMTQKYKLRPKKEHYASMVDILCRSGCFDEAEKLMAQMPFEP 622 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SV+NS +IH N E A +AA Sbjct: 623 DEIMWSSVINSCRIHKNLEFAKKAA 647 >gb|KHM99218.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 765 Score = 112 bits (281), Expect = 7e-23 Identities = 51/85 (60%), Positives = 66/85 (77%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 + ACSH GLV+EG Q F SM + Y + P+K HY+ +VD+L R GRFDE EKL+A+MPFEP Sbjct: 545 LCACSHCGLVEEGQQYFNSMAQDYKLVPRKEHYASIVDMLCRSGRFDEAEKLMAQMPFEP 604 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+S+LNS IH N ELA +AA Sbjct: 605 DEIMWSSILNSCSIHKNQELAKKAA 629 >ref|XP_010660688.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Vitis vinifera] Length = 784 Score = 112 bits (280), Expect = 1e-22 Identities = 51/85 (60%), Positives = 68/85 (80%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSHSGLV+EGL F SM ++Y + P++ HY+ VVD+L R GRF+E EKL+A MP +P Sbjct: 519 LSACSHSGLVEEGLWHFNSMTQIYKLDPRREHYASVVDMLCRSGRFNEAEKLMAEMPIDP 578 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SVLN+ +IH N ELA RAA Sbjct: 579 DEIMWSSVLNACRIHKNQELARRAA 603 >emb|CBI21281.3| unnamed protein product [Vitis vinifera] Length = 785 Score = 112 bits (280), Expect = 1e-22 Identities = 51/85 (60%), Positives = 68/85 (80%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSHSGLV+EGL F SM ++Y + P++ HY+ VVD+L R GRF+E EKL+A MP +P Sbjct: 520 LSACSHSGLVEEGLWHFNSMTQIYKLDPRREHYASVVDMLCRSGRFNEAEKLMAEMPIDP 579 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SVLN+ +IH N ELA RAA Sbjct: 580 DEIMWSSVLNACRIHKNQELARRAA 604 >ref|XP_006446942.1| hypothetical protein CICLE_v10014272mg [Citrus clementina] gi|557549553|gb|ESR60182.1| hypothetical protein CICLE_v10014272mg [Citrus clementina] Length = 830 Score = 112 bits (280), Expect = 1e-22 Identities = 51/85 (60%), Positives = 67/85 (78%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSH GL++EGLQ F SM + Y ++PKK HY +VD+L R G FDE EKL+A+MPFEP Sbjct: 565 LSACSHCGLIEEGLQYFNSMTQKYKLRPKKEHYVSMVDILCRSGCFDEAEKLMAQMPFEP 624 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SV+NS +IH N E A +AA Sbjct: 625 DEIMWSSVINSCRIHKNLEFAKKAA 649 >ref|XP_008450146.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Cucumis melo] Length = 816 Score = 112 bits (279), Expect = 1e-22 Identities = 51/85 (60%), Positives = 66/85 (77%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSH G V+E L F SM ++Y V PK+ HY+ +VD+L R GRFDE EKL+ +MPFEP Sbjct: 551 LSACSHCGFVEEALWHFNSMTQIYEVTPKREHYTSMVDVLCRNGRFDEAEKLMTQMPFEP 610 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 +I+W+SVLNS +IH NHELA +AA Sbjct: 611 SEIMWSSVLNSCRIHKNHELAKKAA 635 >ref|XP_004148020.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Cucumis sativus] gi|700203014|gb|KGN58147.1| hypothetical protein Csa_3G560220 [Cucumis sativus] Length = 816 Score = 111 bits (278), Expect = 2e-22 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 +SACSH G V+E L F SM ++Y V PK+ HY+ +VD+L R GRFDE EKL+ MPFEP Sbjct: 551 LSACSHCGFVEEALWHFNSMTQIYEVTPKREHYTSMVDVLCRNGRFDEAEKLMTEMPFEP 610 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 +I+W+SVLNS +IH NHELA +AA Sbjct: 611 SEIMWSSVLNSCRIHKNHELAKKAA 635 >ref|NP_186850.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75193830|sp|Q9S7F4.1|PP206_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At2g01510 gi|6091739|gb|AAF03451.1|AC010797_27 hypothetical protein [Arabidopsis thaliana] gi|6513930|gb|AAF14834.1|AC011664_16 hypothetical protein [Arabidopsis thaliana] gi|332640228|gb|AEE73749.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 825 Score = 111 bits (278), Expect = 2e-22 Identities = 48/85 (56%), Positives = 66/85 (77%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 ++ACSH G V++G + F++M +Y + PKK HY+C++DLLGR GRF E EKL+ MPFEP Sbjct: 560 LTACSHCGFVEQGTEYFQAMSPIYGITPKKKHYACMLDLLGRNGRFAEAEKLMDEMPFEP 619 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SVLN+ +IH N LA RAA Sbjct: 620 DEIMWSSVLNACRIHKNQSLAERAA 644 >ref|XP_012067344.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Jatropha curcas] Length = 815 Score = 111 bits (277), Expect = 2e-22 Identities = 49/84 (58%), Positives = 68/84 (80%) Frame = +1 Query: 25 SACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEPD 204 +ACSH GLV+EGL+ F SM ++Y + PK+ HY+ +VD+L R G+FD+ EKLIA MPF+PD Sbjct: 551 TACSHWGLVEEGLRYFNSMTKVYKLVPKREHYASIVDVLCRSGKFDKAEKLIAEMPFDPD 610 Query: 205 QIIWNSVLNSSQIHSNHELASRAA 276 +I+W+S+LNS +IH N +LA RAA Sbjct: 611 EIMWSSILNSCRIHKNQDLAKRAA 634 >ref|XP_008231187.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Prunus mume] Length = 899 Score = 111 bits (277), Expect = 2e-22 Identities = 51/85 (60%), Positives = 67/85 (78%) Frame = +1 Query: 22 ISACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEP 201 ++ACSH GLV+EGLQ F S+ + PK+ HY+ +VD+L R GRF+E EKL+A+MPFEP Sbjct: 634 LTACSHCGLVEEGLQYFNSLNRNCKIVPKREHYASMVDMLCRSGRFNEAEKLMAQMPFEP 693 Query: 202 DQIIWNSVLNSSQIHSNHELASRAA 276 D+I+W+SVLNS +IH N ELA RAA Sbjct: 694 DEIMWSSVLNSCKIHKNQELAERAA 718 >gb|KDP41851.1| hypothetical protein JCGZ_26869 [Jatropha curcas] Length = 934 Score = 111 bits (277), Expect = 2e-22 Identities = 49/84 (58%), Positives = 68/84 (80%) Frame = +1 Query: 25 SACSHSGLVDEGLQCFESMEELYMVKPKKVHYSCVVDLLGRMGRFDEVEKLIARMPFEPD 204 +ACSH GLV+EGL+ F SM ++Y + PK+ HY+ +VD+L R G+FD+ EKLIA MPF+PD Sbjct: 670 TACSHWGLVEEGLRYFNSMTKVYKLVPKREHYASIVDVLCRSGKFDKAEKLIAEMPFDPD 729 Query: 205 QIIWNSVLNSSQIHSNHELASRAA 276 +I+W+S+LNS +IH N +LA RAA Sbjct: 730 EIMWSSILNSCRIHKNQDLAKRAA 753