BLASTX nr result
ID: Anemarrhena21_contig00055122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00055122 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096601.1| PREDICTED: F-box protein At4g18380-like [Ses... 60 6e-07 ref|XP_012830234.1| PREDICTED: F-box protein At5g46170-like [Ery... 60 7e-07 ref|XP_009758227.1| PREDICTED: F-box protein At4g18380-like [Nic... 59 1e-06 ref|XP_009625759.1| PREDICTED: F-box protein At5g46170-like [Nic... 59 1e-06 emb|CDP21114.1| unnamed protein product [Coffea canephora] 58 2e-06 ref|XP_006355407.1| PREDICTED: F-box protein At5g46170-like [Sol... 58 3e-06 >ref|XP_011096601.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum] Length = 392 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 33 MGSVKLDLYSRIYPEPIDHFDMLPDSILLLIFNK 134 MGS++ DL SRI+PEPIDHFD LPDS++LLIFNK Sbjct: 1 MGSIRADLGSRIHPEPIDHFDRLPDSVILLIFNK 34 >ref|XP_012830234.1| PREDICTED: F-box protein At5g46170-like [Erythranthe guttatus] gi|604344500|gb|EYU43254.1| hypothetical protein MIMGU_mgv1a008300mg [Erythranthe guttata] Length = 378 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 33 MGSVKLDLYSRIYPEPIDHFDMLPDSILLLIFNK 134 MGS++ DL SRI+PEPIDHFD LPDS++LLIFNK Sbjct: 1 MGSIRADLGSRIHPEPIDHFDHLPDSVILLIFNK 34 >ref|XP_009758227.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris] Length = 396 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 33 MGSVKLDLYSRIYPEPIDHFDMLPDSILLLIFNK 134 MGS K DL S IYPEP+DHFD LPDSILLL+FNK Sbjct: 1 MGSSKSDLRSTIYPEPVDHFDRLPDSILLLVFNK 34 >ref|XP_009625759.1| PREDICTED: F-box protein At5g46170-like [Nicotiana tomentosiformis] Length = 385 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 33 MGSVKLDLYSRIYPEPIDHFDMLPDSILLLIFNK 134 MGS K DL S IYPEP+DHFD LPDSILLL+FNK Sbjct: 1 MGSSKSDLRSTIYPEPVDHFDRLPDSILLLVFNK 34 >emb|CDP21114.1| unnamed protein product [Coffea canephora] Length = 420 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +3 Query: 33 MGSVKLDLYSRIYPEPIDHFDMLPDSILLLIFNK 134 MGS++ DL ++I+PEP+DHFD LPDS+LLL+FNK Sbjct: 1 MGSIRADLSTKIFPEPVDHFDRLPDSLLLLVFNK 34 >ref|XP_006355407.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum] Length = 389 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 33 MGSVKLDLYSRIYPEPIDHFDMLPDSILLLIFNK 134 MGS K DL S IYPEP+DHFD LPD +LLLIFNK Sbjct: 1 MGSSKSDLRSTIYPEPVDHFDQLPDPVLLLIFNK 34