BLASTX nr result
ID: Anemarrhena21_contig00055075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00055075 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008022143.1| hypothetical protein SETTUDRAFT_158864 [Seto... 120 4e-25 ref|XP_007684122.1| hypothetical protein COCMIDRAFT_84672 [Bipol... 118 1e-24 ref|XP_007711962.1| hypothetical protein COCCADRAFT_95228, parti... 118 1e-24 ref|XP_007703597.1| hypothetical protein COCSADRAFT_40040 [Bipol... 118 1e-24 gb|EUN31078.1| hypothetical protein COCVIDRAFT_88740, partial [B... 117 4e-24 ref|XP_001930380.1| glutaredoxin domain containing protein [Pyre... 115 1e-23 gb|EMD90450.1| hypothetical protein COCHEDRAFT_1157461 [Bipolari... 114 2e-23 ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora ... 114 3e-23 ref|XP_001802021.1| hypothetical protein SNOG_11783 [Phaeosphaer... 113 4e-23 ref|XP_003844117.1| similar to glutaredoxin [Leptosphaeria macul... 109 8e-22 gb|KFY88278.1| hypothetical protein V500_06439 [Pseudogymnoascus... 106 7e-21 gb|KFY17506.1| hypothetical protein V491_04977 [Pseudogymnoascus... 104 2e-20 gb|KFY02369.1| hypothetical protein O988_02197 [Pseudogymnoascus... 104 2e-20 ref|XP_001269551.1| glutaredoxin, putative [Aspergillus clavatus... 104 3e-20 gb|KFY13302.1| hypothetical protein V492_03362 [Pseudogymnoascus... 103 5e-20 gb|KFX88285.1| hypothetical protein V490_07739 [Pseudogymnoascus... 103 6e-20 gb|KFY70280.1| hypothetical protein V499_09302 [Pseudogymnoascus... 102 8e-20 gb|KFY62752.1| hypothetical protein V496_04419 [Pseudogymnoascus... 102 8e-20 ref|XP_007778836.1| glutaredoxin 3 [Coniosporium apollinis CBS 1... 102 1e-19 gb|KFY37160.1| hypothetical protein V494_04874 [Pseudogymnoascus... 101 2e-19 >ref|XP_008022143.1| hypothetical protein SETTUDRAFT_158864 [Setosphaeria turcica Et28A] gi|482813570|gb|EOA90261.1| hypothetical protein SETTUDRAFT_158864 [Setosphaeria turcica Et28A] Length = 134 Score = 120 bits (301), Expect = 4e-25 Identities = 60/71 (84%), Positives = 65/71 (91%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLSESGAKFYAIELDQVDDGS IQ +L ++TGQ+TVPNIFI QKHIGGNSDLQAKKG Sbjct: 64 KQLLSESGAKFYAIELDQVDDGSAIQAALGEITGQTTVPNIFIAQKHIGGNSDLQAKKGQ 123 Query: 152 LATLLKDAGAV 120 L TLLKDAGA+ Sbjct: 124 LNTLLKDAGAL 134 >ref|XP_007684122.1| hypothetical protein COCMIDRAFT_84672 [Bipolaris oryzae ATCC 44560] gi|576935886|gb|EUC49386.1| hypothetical protein COCMIDRAFT_84672 [Bipolaris oryzae ATCC 44560] Length = 138 Score = 118 bits (296), Expect = 1e-24 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLS SGAKFYAIELDQVDDGS IQ LAD+TGQ TVPNIFI Q+HIGGNSDLQAKKG+ Sbjct: 68 KQLLSASGAKFYAIELDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGE 127 Query: 152 LATLLKDAGAV 120 L TLLKDAGA+ Sbjct: 128 LNTLLKDAGAL 138 >ref|XP_007711962.1| hypothetical protein COCCADRAFT_95228, partial [Bipolaris zeicola 26-R-13] gi|576919555|gb|EUC33727.1| hypothetical protein COCCADRAFT_95228, partial [Bipolaris zeicola 26-R-13] Length = 137 Score = 118 bits (296), Expect = 1e-24 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLS SGAKFYAIELDQVDDGS IQ LAD+TGQ TVPNIFI Q+HIGGNSDLQAKKG+ Sbjct: 67 KQLLSASGAKFYAIELDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGE 126 Query: 152 LATLLKDAGAV 120 L TLLKDAGA+ Sbjct: 127 LNTLLKDAGAL 137 >ref|XP_007703597.1| hypothetical protein COCSADRAFT_40040 [Bipolaris sorokiniana ND90Pr] gi|451847092|gb|EMD60400.1| hypothetical protein COCSADRAFT_40040 [Bipolaris sorokiniana ND90Pr] Length = 102 Score = 118 bits (296), Expect = 1e-24 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLS SGAKFYAIELDQVDDGS IQ LAD+TGQ TVPNIFI Q+HIGGNSDLQAKKG+ Sbjct: 32 KQLLSASGAKFYAIELDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGE 91 Query: 152 LATLLKDAGAV 120 L TLLKDAGA+ Sbjct: 92 LNTLLKDAGAL 102 >gb|EUN31078.1| hypothetical protein COCVIDRAFT_88740, partial [Bipolaris victoriae FI3] Length = 137 Score = 117 bits (292), Expect = 4e-24 Identities = 59/71 (83%), Positives = 64/71 (90%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLS SGAKF+AIELDQVDDGS IQ LAD+TGQ TVPNIFI Q+HIGGNSDLQAKKG+ Sbjct: 67 KQLLSASGAKFFAIELDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGE 126 Query: 152 LATLLKDAGAV 120 L TLLKDAGA+ Sbjct: 127 LNTLLKDAGAL 137 >ref|XP_001930380.1| glutaredoxin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187971986|gb|EDU39485.1| glutaredoxin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 102 Score = 115 bits (287), Expect = 1e-23 Identities = 56/71 (78%), Positives = 64/71 (90%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLL++ GAKFYAIELDQVDDGS +Q +L DLTGQ++VPNIFI QKHIGGNSDLQAKKG+ Sbjct: 32 KQLLTDKGAKFYAIELDQVDDGSAMQAALGDLTGQTSVPNIFIAQKHIGGNSDLQAKKGE 91 Query: 152 LATLLKDAGAV 120 L LLK+AGAV Sbjct: 92 LPNLLKEAGAV 102 >gb|EMD90450.1| hypothetical protein COCHEDRAFT_1157461 [Bipolaris maydis C5] gi|477592266|gb|ENI09337.1| hypothetical protein COCC4DRAFT_127100 [Bipolaris maydis ATCC 48331] Length = 138 Score = 114 bits (286), Expect = 2e-23 Identities = 58/71 (81%), Positives = 63/71 (88%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLS SGAKFYAIELDQVDDGS IQ LAD+TGQ TVPNIFI Q+HIGGNSDLQAK+G+ Sbjct: 68 KQLLSASGAKFYAIELDQVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKRGE 127 Query: 152 LATLLKDAGAV 120 L TLLK AGA+ Sbjct: 128 LNTLLKGAGAL 138 >ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] gi|311326524|gb|EFQ92211.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] Length = 102 Score = 114 bits (285), Expect = 3e-23 Identities = 56/71 (78%), Positives = 63/71 (88%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLL++ GAKFYAIELDQVDDGS +Q L DLTGQ+TVPNIFI QKHIGGNSDLQAKKG+ Sbjct: 32 KQLLTDKGAKFYAIELDQVDDGSAMQSVLGDLTGQTTVPNIFIAQKHIGGNSDLQAKKGE 91 Query: 152 LATLLKDAGAV 120 L LLK+AGA+ Sbjct: 92 LPNLLKEAGAL 102 >ref|XP_001802021.1| hypothetical protein SNOG_11783 [Phaeosphaeria nodorum SN15] gi|160703361|gb|EAT80827.2| hypothetical protein SNOG_11783 [Phaeosphaeria nodorum SN15] Length = 143 Score = 113 bits (283), Expect = 4e-23 Identities = 55/71 (77%), Positives = 65/71 (91%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K+LLS+SGAKFYAIELDQVDDGS IQ +L ++TGQ+TVPNIFI ++HIGGNSDLQAKK + Sbjct: 73 KELLSQSGAKFYAIELDQVDDGSAIQSTLGEMTGQTTVPNIFIAKEHIGGNSDLQAKKNN 132 Query: 152 LATLLKDAGAV 120 L TLLKDAGA+ Sbjct: 133 LKTLLKDAGAL 143 >ref|XP_003844117.1| similar to glutaredoxin [Leptosphaeria maculans JN3] gi|312220697|emb|CBY00638.1| similar to glutaredoxin [Leptosphaeria maculans JN3] Length = 102 Score = 109 bits (272), Expect = 8e-22 Identities = 53/71 (74%), Positives = 63/71 (88%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLSESGAKFYAIELDQVDDGS IQ +L ++TGQ+TVP+IFI QKHIGGNSDLQ+K+ + Sbjct: 32 KQLLSESGAKFYAIELDQVDDGSAIQSALGEMTGQTTVPSIFIAQKHIGGNSDLQSKRRE 91 Query: 152 LATLLKDAGAV 120 L +LK AGA+ Sbjct: 92 LKNMLKSAGAL 102 >gb|KFY88278.1| hypothetical protein V500_06439 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682468614|gb|KFZ22718.1| hypothetical protein V502_02802 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 103 Score = 106 bits (264), Expect = 7e-21 Identities = 51/71 (71%), Positives = 61/71 (85%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E GAKFYAIELDQV+DGS IQ +L ++TGQ++VPNIFIG+KHIGGNSDLQ KK Sbjct: 33 KALLTEKGAKFYAIELDQVEDGSAIQAALGEMTGQTSVPNIFIGKKHIGGNSDLQEKKSQ 92 Query: 152 LATLLKDAGAV 120 L LLK+AGA+ Sbjct: 93 LTNLLKEAGAL 103 >gb|KFY17506.1| hypothetical protein V491_04977 [Pseudogymnoascus pannorum VKM F-3775] Length = 103 Score = 104 bits (260), Expect = 2e-20 Identities = 50/71 (70%), Positives = 61/71 (85%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E GAKFY+IELDQVDDGS IQ +L +LTGQ++VPNIFI +KHIGGNSDLQ +K + Sbjct: 33 KALLNEKGAKFYSIELDQVDDGSAIQAALGELTGQTSVPNIFINKKHIGGNSDLQERKSE 92 Query: 152 LATLLKDAGAV 120 L LLK+AGA+ Sbjct: 93 LTNLLKEAGAL 103 >gb|KFY02369.1| hypothetical protein O988_02197 [Pseudogymnoascus pannorum VKM F-3808] Length = 103 Score = 104 bits (260), Expect = 2e-20 Identities = 50/71 (70%), Positives = 60/71 (84%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E GAKFY+IELDQVDDGS IQ +L ++TGQ++VPNIFI +KHIGGNSDLQ KK Sbjct: 33 KSLLNEKGAKFYSIELDQVDDGSAIQTALGEMTGQTSVPNIFINKKHIGGNSDLQEKKAQ 92 Query: 152 LATLLKDAGAV 120 L LLK+AGA+ Sbjct: 93 LTNLLKEAGAL 103 >ref|XP_001269551.1| glutaredoxin, putative [Aspergillus clavatus NRRL 1] gi|119397694|gb|EAW08125.1| glutaredoxin, putative [Aspergillus clavatus NRRL 1] Length = 102 Score = 104 bits (259), Expect = 3e-20 Identities = 50/71 (70%), Positives = 61/71 (85%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQ L+E GAKFYA+ELDQ+DDG++IQ +L ++T Q +VPNIFIGQKHIGGNSDLQAKK + Sbjct: 32 KQTLNELGAKFYALELDQIDDGTEIQNALYEITQQRSVPNIFIGQKHIGGNSDLQAKKAE 91 Query: 152 LATLLKDAGAV 120 L LLK AGA+ Sbjct: 92 LPQLLKAAGAL 102 >gb|KFY13302.1| hypothetical protein V492_03362 [Pseudogymnoascus pannorum VKM F-4246] Length = 103 Score = 103 bits (257), Expect = 5e-20 Identities = 50/71 (70%), Positives = 60/71 (84%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E GAKFY+IELDQV+DGS IQ +L ++TGQ++VPNIFI +KHIGGNSDLQ KK + Sbjct: 33 KSLLNEKGAKFYSIELDQVEDGSAIQAALGEMTGQTSVPNIFINKKHIGGNSDLQEKKSE 92 Query: 152 LATLLKDAGAV 120 L LLK AGAV Sbjct: 93 LTNLLKAAGAV 103 >gb|KFX88285.1| hypothetical protein V490_07739 [Pseudogymnoascus pannorum VKM F-3557] gi|682375665|gb|KFY60120.1| hypothetical protein V497_03847 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 103 Score = 103 bits (256), Expect = 6e-20 Identities = 49/71 (69%), Positives = 60/71 (84%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E GAKFY+IELDQV+DGS IQ +L ++TGQ++VPNIFI +KHIGGNSDLQ KK Sbjct: 33 KSLLNEKGAKFYSIELDQVEDGSAIQAALGEMTGQTSVPNIFINKKHIGGNSDLQEKKAQ 92 Query: 152 LATLLKDAGAV 120 L LLK+AGA+ Sbjct: 93 LTNLLKEAGAL 103 >gb|KFY70280.1| hypothetical protein V499_09302 [Pseudogymnoascus pannorum VKM F-103] gi|682448940|gb|KFZ08929.1| hypothetical protein V501_05773 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 103 Score = 102 bits (255), Expect = 8e-20 Identities = 49/71 (69%), Positives = 60/71 (84%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E GAKFY+IELDQV+DGS IQ +L ++TGQ++VPNIFI +KHIGGNSDLQ KK Sbjct: 33 KALLNEKGAKFYSIELDQVEDGSAIQAALGEMTGQTSVPNIFINKKHIGGNSDLQEKKSQ 92 Query: 152 LATLLKDAGAV 120 L LLK+AGA+ Sbjct: 93 LTNLLKEAGAL 103 >gb|KFY62752.1| hypothetical protein V496_04419 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682401749|gb|KFY78360.1| hypothetical protein V498_09124 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 103 Score = 102 bits (255), Expect = 8e-20 Identities = 49/71 (69%), Positives = 61/71 (85%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E+GAKFY+IELDQV+DGS IQ +L ++TGQ++VPNIFI +KHIGGNSDLQ KK Sbjct: 33 KALLNETGAKFYSIELDQVEDGSAIQAALGEMTGQTSVPNIFINKKHIGGNSDLQEKKAQ 92 Query: 152 LATLLKDAGAV 120 L LLK+AGA+ Sbjct: 93 LPALLKEAGAL 103 >ref|XP_007778836.1| glutaredoxin 3 [Coniosporium apollinis CBS 100218] gi|494826437|gb|EON63519.1| glutaredoxin 3 [Coniosporium apollinis CBS 100218] Length = 102 Score = 102 bits (253), Expect = 1e-19 Identities = 51/71 (71%), Positives = 60/71 (84%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 KQLLSE GAKFYAIELDQVDDG+ IQ +L ++T Q TVPN+FI +KHIGGNSDLQ+KK + Sbjct: 32 KQLLSEMGAKFYAIELDQVDDGAAIQDALEEMTHQRTVPNVFIDKKHIGGNSDLQSKKKE 91 Query: 152 LATLLKDAGAV 120 L LL+ AGAV Sbjct: 92 LPKLLQTAGAV 102 >gb|KFY37160.1| hypothetical protein V494_04874 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 103 Score = 101 bits (252), Expect = 2e-19 Identities = 49/71 (69%), Positives = 60/71 (84%) Frame = -2 Query: 332 KQLLSESGAKFYAIELDQVDDGSDIQRSLADLTGQSTVPNIFIGQKHIGGNSDLQAKKGD 153 K LL+E GAKF++IELDQV+DGS IQ +L +LTGQ++VPNIFI +KHIGGNSDLQ KK + Sbjct: 33 KSLLNEKGAKFFSIELDQVEDGSAIQAALGELTGQTSVPNIFINKKHIGGNSDLQEKKSE 92 Query: 152 LATLLKDAGAV 120 L LLK AGA+ Sbjct: 93 LTNLLKAAGAL 103