BLASTX nr result
ID: Anemarrhena21_contig00054610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00054610 (365 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009127897.1| hypothetical chloroplast RF21 (chloroplast) ... 64 3e-08 ref|YP_009108471.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|... 63 9e-08 gb|ABD16783.1| probable ATPase, partial (chloroplast) [Fuchsia h... 63 9e-08 ref|YP_009139722.1| hypothetical chloroplast RF21 (chloroplast) ... 62 1e-07 ref|YP_009136522.1| Ycf2 (chloroplast) [Prunus padus] gi|8175278... 62 1e-07 ref|YP_009136438.1| Ycf2 (chloroplast) [Prunus maximowiczii] gi|... 62 1e-07 ref|YP_009136354.1| Ycf2 (chloroplast) [Prunus yedoensis] gi|817... 62 1e-07 ref|YP_009110396.1| hypothetical chloroplast RF21 (chloroplast) ... 62 1e-07 gb|ADD30893.1| putative RF2 protein (chloroplast) [Ficus sp. Moo... 62 1e-07 gb|ADB24086.1| Ycf2 [Cynomorium songaricum] 62 1e-07 gb|ACY07930.1| Ycf2 [Cynomorium songaricum] 62 1e-07 gb|AAD19611.1| YCF2 protein [Prunus dulcis] 62 1e-07 ref|YP_009024724.1| hypothetical chloroplast RF21 (chloroplast) ... 62 1e-07 ref|YP_009020082.1| hypothetical chloroplast RF21 [Prunus mume] ... 62 1e-07 ref|YP_008965535.1| hypothetical chloroplast RF21 [Pyrus spinosa... 62 1e-07 ref|YP_008082793.1| hypothetical chloroplast RF21 [Prinsepia uti... 62 1e-07 ref|YP_008082776.1| hypothetical chloroplast RF21 [Prinsepia uti... 62 1e-07 ref|YP_005296143.1| ycf2 gene product (chloroplast) [Pentactina ... 62 1e-07 gb|AEX93989.1| hypothetical chloroplast RF21 (chloroplast) [Trit... 62 1e-07 gb|AEX93960.1| hypothetical chloroplast RF21 (chloroplast) [Aphy... 62 1e-07 >ref|YP_009127897.1| hypothetical chloroplast RF21 (chloroplast) [Tamarindus indica] gi|772657389|ref|YP_009127914.1| hypothetical chloroplast RF21 (chloroplast) [Tamarindus indica] Length = 2317 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR V+QN LLRNCSIDPISIYM GDSY ++ Sbjct: 1911 VQDHGILFYQTGRAVSQNVLLRNCSIDPISIYMKKKSCNEGDSYLYK 1957 >ref|YP_009108471.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|723456783|ref|YP_009108475.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|702068555|emb|CDI44031.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|702068559|emb|CDI44038.1| Ycf2 (chloroplast) [Genlisea margaretae] Length = 2279 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LLRNC IDPISIYM GDSY ++ Sbjct: 1872 VQDHGILFYQIGRAVAQNVLLRNCPIDPISIYMKKKSCNEGDSYLYK 1918 >gb|ABD16783.1| probable ATPase, partial (chloroplast) [Fuchsia hybrid cultivar] Length = 296 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LLRNC IDPISIYM GDSY ++ Sbjct: 238 VQDHGILFYQIGRAVAQNVLLRNCPIDPISIYMKKKSCDEGDSYLYK 284 >ref|YP_009139722.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] gi|821318616|ref|YP_009139739.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] gi|818638163|gb|AKF34029.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] gi|818638168|gb|AKF34028.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] Length = 2292 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1892 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1938 >ref|YP_009136522.1| Ycf2 (chloroplast) [Prunus padus] gi|817527862|ref|YP_009136539.1| Ycf2 (chloroplast) [Prunus padus] gi|808178398|gb|AKC99728.1| Ycf2 (chloroplast) [Prunus padus] gi|808178414|gb|AKC99744.1| Ycf2 (chloroplast) [Prunus padus] Length = 2280 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1889 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1935 >ref|YP_009136438.1| Ycf2 (chloroplast) [Prunus maximowiczii] gi|817527625|ref|YP_009136455.1| Ycf2 (chloroplast) [Prunus maximowiczii] gi|808178313|gb|AKC99644.1| Ycf2 (chloroplast) [Prunus maximowiczii] gi|808178330|gb|AKC99661.1| Ycf2 (chloroplast) [Prunus maximowiczii] gi|808178483|gb|AKC99812.1| Ycf2 (chloroplast) [Prunus serrulata var. spontanea] gi|808178500|gb|AKC99829.1| Ycf2 (chloroplast) [Prunus serrulata var. spontanea] Length = 2277 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1886 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1932 >ref|YP_009136354.1| Ycf2 (chloroplast) [Prunus yedoensis] gi|817527385|ref|YP_009136371.1| Ycf2 (chloroplast) [Prunus yedoensis] gi|808178227|gb|AKC99559.1| Ycf2 (chloroplast) [Prunus yedoensis] gi|808178243|gb|AKC99575.1| Ycf2 (chloroplast) [Prunus yedoensis] gi|808178571|gb|AKC99899.1| Ycf2 (chloroplast) [Prunus subhirtella var. subhirtella] gi|808178588|gb|AKC99916.1| Ycf2 (chloroplast) [Prunus subhirtella var. subhirtella] gi|808178653|gb|AKC99980.1| Ycf2 (chloroplast) [Prunus subhirtella var. subhirtella] gi|808178670|gb|AKC99997.1| Ycf2 (chloroplast) [Prunus subhirtella var. subhirtella] Length = 2275 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1886 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1932 >ref|YP_009110396.1| hypothetical chloroplast RF21 (chloroplast) [Morus mongolica] Length = 2294 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1894 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1940 >gb|ADD30893.1| putative RF2 protein (chloroplast) [Ficus sp. Moore 315] gi|340807156|gb|AEK71751.1| hypothetical chloroplast RF2 [Ficus sp. M. J. Moore 315] Length = 2289 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1894 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1940 >gb|ADB24086.1| Ycf2 [Cynomorium songaricum] Length = 2288 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1900 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1946 >gb|ACY07930.1| Ycf2 [Cynomorium songaricum] Length = 226 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 90 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 136 >gb|AAD19611.1| YCF2 protein [Prunus dulcis] Length = 135 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 82 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 128 >ref|YP_009024724.1| hypothetical chloroplast RF21 (chloroplast) [Prunus kansuensis] gi|628249224|ref|YP_009024742.1| hypothetical chloroplast RF21 (chloroplast) [Prunus kansuensis] gi|597569148|gb|AHN13579.1| hypothetical chloroplast RF21 (chloroplast) [Prunus kansuensis] gi|597569166|gb|AHN13597.1| hypothetical chloroplast RF21 (chloroplast) [Prunus kansuensis] Length = 2279 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1888 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1934 >ref|YP_009020082.1| hypothetical chloroplast RF21 [Prunus mume] gi|595789826|ref|YP_009020099.1| hypothetical chloroplast RF21 [Prunus mume] gi|589061095|gb|AHK26916.1| hypothetical chloroplast RF21 [Prunus mume] gi|589061112|gb|AHK26933.1| hypothetical chloroplast RF21 [Prunus mume] Length = 2277 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1886 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1932 >ref|YP_008965535.1| hypothetical chloroplast RF21 [Pyrus spinosa] gi|568246791|ref|YP_008965553.1| hypothetical chloroplast RF21 [Pyrus spinosa] gi|565666507|emb|CDI73607.1| hypothetical chloroplast RF21 [Pyrus spinosa] gi|565666525|emb|CDI73626.1| hypothetical chloroplast RF21 [Pyrus spinosa] Length = 2279 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1891 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1937 >ref|YP_008082793.1| hypothetical chloroplast RF21 [Prinsepia utilis] gi|501418883|gb|AGL94760.1| hypothetical chloroplast RF21 [Prinsepia utilis] Length = 2278 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1885 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1931 >ref|YP_008082776.1| hypothetical chloroplast RF21 [Prinsepia utilis] gi|501418865|gb|AGL94742.1| hypothetical chloroplast RF21 [Prinsepia utilis] Length = 2281 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1888 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1934 >ref|YP_005296143.1| ycf2 gene product (chloroplast) [Pentactina rupicola] gi|377829933|ref|YP_005296160.1| ycf2 gene product (chloroplast) [Pentactina rupicola] gi|371532664|gb|AEX31774.1| hypothetical chloroplast RF2 (chloroplast) [Pentactina rupicola] gi|371532681|gb|AEX31791.1| hypothetical chloroplast RF2 (chloroplast) [Pentactina rupicola] Length = 2282 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1889 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCNEGDSYLYK 1935 >gb|AEX93989.1| hypothetical chloroplast RF21 (chloroplast) [Triteleia hyacinthina] Length = 2276 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1881 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCKEGDSYLYK 1927 >gb|AEX93960.1| hypothetical chloroplast RF21 (chloroplast) [Aphyllanthes monspeliensis] Length = 2271 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 224 VLDHGIVLYQEGRVVAQNELLRNCSIDPISIYMXXXXXXRGDSYKFE 364 V DHGI+ YQ GR VAQN LL NCSIDPISIYM GDSY ++ Sbjct: 1873 VQDHGILFYQIGRAVAQNVLLSNCSIDPISIYMKKKSCKEGDSYLYK 1919