BLASTX nr result
ID: Anemarrhena21_contig00054328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00054328 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010027409.1| PREDICTED: uncharacterized protein LOC104417... 40 6e-07 >ref|XP_010027409.1| PREDICTED: uncharacterized protein LOC104417910 [Eucalyptus grandis] Length = 834 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 17/35 (48%), Positives = 26/35 (74%) Frame = -2 Query: 133 DDILLIGSNSTGLVEMK*YLKCHFVTKDMGKPKYF 29 DDI++ GS+ TG+ E+K +L+ HF KD+G +YF Sbjct: 575 DDIIVSGSDMTGIFEIKSFLQQHFQIKDLGTLRYF 609 Score = 39.7 bits (91), Expect(2) = 6e-07 Identities = 20/34 (58%), Positives = 23/34 (67%) Frame = -1 Query: 236 KFSMVISGIGFQRYHSDHPVFVHHTMSGFVILVV 135 KFS VIS GF + +SDH +FV SG VILVV Sbjct: 539 KFSSVISKCGFHQCYSDHSIFVRKKESGVVILVV 572