BLASTX nr result
ID: Anemarrhena21_contig00054274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00054274 (227 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010251440.1| PREDICTED: two-component response regulator-... 63 7e-08 ref|XP_010909922.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_010909921.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_010909920.1| PREDICTED: two-component response regulator-... 61 3e-07 >ref|XP_010251440.1| PREDICTED: two-component response regulator-like PRR95 [Nelumbo nucifera] Length = 702 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = -2 Query: 217 ISSATDQSVNSSFCNNSKGHMKSSGCRSICDGSTMNVTATAVDATTFESGNDEGIITSDP 38 +S AT S +SS CN + H+ SSGC SIC+GS NVT A TT ES DE I D Sbjct: 581 VSPATGNSASSSLCNGAVSHLNSSGCGSICNGSNGNVTPAAAGRTTTESETDECIFIHDG 640 Query: 37 VK-VMGERVSQRE 2 ++ + R ++RE Sbjct: 641 IRGINSHRSTERE 653 >ref|XP_010909922.1| PREDICTED: two-component response regulator-like APRR9 isoform X3 [Elaeis guineensis] Length = 659 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = -2 Query: 223 KHISSATDQSVNSSFCNNSKGHMKSSGCRSICDGSTMNVTATAVDATTFESGNDEGIITS 44 +H+SSAT +S + S CN + H+ SSG S C+ ST ++T + + T ESGN++G I Sbjct: 524 RHVSSATAESGSGSVCNGGRSHLNSSGGGSACNESTGHITVSEIFKATTESGNNDGTIAH 583 Query: 43 DPVKVMG-ERVSQRE 2 + K M ++SQRE Sbjct: 584 EGTKPMDFHQLSQRE 598 >ref|XP_010909921.1| PREDICTED: two-component response regulator-like PRR95 isoform X2 [Elaeis guineensis] Length = 705 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = -2 Query: 223 KHISSATDQSVNSSFCNNSKGHMKSSGCRSICDGSTMNVTATAVDATTFESGNDEGIITS 44 +H+SSAT +S + S CN + H+ SSG S C+ ST ++T + + T ESGN++G I Sbjct: 570 RHVSSATAESGSGSVCNGGRSHLNSSGGGSACNESTGHITVSEIFKATTESGNNDGTIAH 629 Query: 43 DPVKVMG-ERVSQRE 2 + K M ++SQRE Sbjct: 630 EGTKPMDFHQLSQRE 644 >ref|XP_010909920.1| PREDICTED: two-component response regulator-like PRR95 isoform X1 [Elaeis guineensis] Length = 706 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = -2 Query: 223 KHISSATDQSVNSSFCNNSKGHMKSSGCRSICDGSTMNVTATAVDATTFESGNDEGIITS 44 +H+SSAT +S + S CN + H+ SSG S C+ ST ++T + + T ESGN++G I Sbjct: 571 RHVSSATAESGSGSVCNGGRSHLNSSGGGSACNESTGHITVSEIFKATTESGNNDGTIAH 630 Query: 43 DPVKVMG-ERVSQRE 2 + K M ++SQRE Sbjct: 631 EGTKPMDFHQLSQRE 645