BLASTX nr result
ID: Anemarrhena21_contig00054011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00054011 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63103.1| gag-pol polyprotein, related [Asparagus officinalis] 64 3e-08 >gb|ABD63103.1| gag-pol polyprotein, related [Asparagus officinalis] Length = 307 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/70 (41%), Positives = 43/70 (61%) Frame = -3 Query: 251 KQTSGISFISSKAFNHDVEKGAPFMILTTRKVAKEPSTPIPPEVTPVIREFADVFPKDLS 72 K G++ I +K + ++ GAP L R+ K+ + P EV PV+ E++DVFP+DLS Sbjct: 220 KSFQGVNLIGAKEIDRELTNGAPIFALAAREAPKDIANAAPSEVVPVLEEYSDVFPEDLS 279 Query: 71 DKLPLTCDIQ 42 D+LP DIQ Sbjct: 280 DQLPQMRDIQ 289