BLASTX nr result
ID: Anemarrhena21_contig00054008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00054008 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010923947.1| PREDICTED: pentatricopeptide repeat-containi... 58 8e-13 ref|XP_008809852.1| PREDICTED: pentatricopeptide repeat-containi... 56 1e-11 ref|XP_009388083.1| PREDICTED: pentatricopeptide repeat-containi... 47 3e-09 >ref|XP_010923947.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170 [Elaeis guineensis] Length = 571 Score = 57.8 bits (138), Expect(2) = 8e-13 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -1 Query: 299 ILKEMIVRDLLPTLPFLDYDWVINRLCELEKTFEMDVFWE 180 +L+EM+VR+LLPT+P LDYDWVI RLC KT+ ++F+E Sbjct: 300 MLREMVVRELLPTVPVLDYDWVIRRLCVQGKTYAAEMFFE 339 Score = 42.0 bits (97), Expect(2) = 8e-13 Identities = 22/47 (46%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = -3 Query: 144 YTSLLRASAKEGRVKEAFEVYRMMLEEGITMNSSYSDVF*VG-CVGE 7 Y +LRA +KEGRV+EA +YR+M +EG+++N F G C GE Sbjct: 353 YLCMLRALSKEGRVEEAMRMYRVMSKEGVSVNPKCCVEFLSGICKGE 399 >ref|XP_008809852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170 [Phoenix dactylifera] Length = 572 Score = 55.8 bits (133), Expect(2) = 1e-11 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = -1 Query: 299 ILKEMIVRDLLPTLPFLDYDWVINRLCELEKTFEMDVFWE 180 +L+EM+VR+LLPT+P LDYDWVI LC KT+ ++F+E Sbjct: 300 MLREMVVRELLPTVPVLDYDWVIRTLCAQGKTYAAEMFFE 339 Score = 39.7 bits (91), Expect(2) = 1e-11 Identities = 21/47 (44%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = -3 Query: 144 YTSLLRASAKEGRVKEAFEVYRMMLEEGITMNSSYSDVF*VG-CVGE 7 Y +LRA ++EGRV+EA +YR+M +EG+++N F G C GE Sbjct: 353 YLCMLRALSEEGRVEEAMRMYRIMSKEGVSVNLKCCVEFVNGICKGE 399 >ref|XP_009388083.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170 [Musa acuminata subsp. malaccensis] Length = 579 Score = 46.6 bits (109), Expect(2) = 3e-09 Identities = 18/46 (39%), Positives = 33/46 (71%) Frame = -1 Query: 299 ILKEMIVRDLLPTLPFLDYDWVINRLCELEKTFEMDVFWEGSRCES 162 +L+ M+V LPT+P L+YD +INR CE+EK++ + ++ +R ++ Sbjct: 309 MLRVMVVHGFLPTVPCLEYDRIINRFCEMEKSYAAKMLFDRARIQN 354 Score = 41.2 bits (95), Expect(2) = 3e-09 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = -3 Query: 144 YTSLLRASAKEGRVKEAFEVYRMMLEEGITMNSSYSDVF 28 Y SLL+A + EGRV+ A E+Y +M E+GI +N S VF Sbjct: 362 YVSLLKALSNEGRVQHAMELYVIMSEKGIKVNPSSCSVF 400