BLASTX nr result
ID: Anemarrhena21_contig00053897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00053897 (720 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008778191.1| PREDICTED: E3 ubiquitin-protein ligase At1g1... 57 3e-07 >ref|XP_008778191.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Phoenix dactylifera] Length = 361 Score = 57.0 bits (136), Expect(2) = 3e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +1 Query: 412 TDSGISEGEGEATVQLEERQYEWSYSKLVVTLNLVWNMAFVLISAS 549 T + ++ A +QLEER Y+W YSK VV L+LVWN+AFVL+SAS Sbjct: 60 TAAAVAAMRETAALQLEERHYDWGYSKPVVALDLVWNLAFVLVSAS 105 Score = 25.0 bits (53), Expect(2) = 3e-07 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 Query: 546 LLLFTSRERPSTFIRA 593 +LL T+RERPST IRA Sbjct: 106 VLLSTARERPSTPIRA 121