BLASTX nr result
ID: Anemarrhena21_contig00053834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00053834 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF98303.1| geranylgeranyl-diphosphate synthase [Hevea brasi... 60 7e-07 ref|XP_011045566.1| PREDICTED: heterodimeric geranylgeranyl pyro... 59 1e-06 ref|XP_010266070.1| PREDICTED: heterodimeric geranylgeranyl pyro... 59 1e-06 ref|XP_002312936.2| geranylgeranyl pyrophosphate synthase family... 59 1e-06 ref|XP_002306207.2| hypothetical protein POPTR_0004s18610g [Popu... 58 3e-06 gb|AIG15450.1| geranylgeranyl diphosphate synthase 1 [Azadiracht... 57 4e-06 >dbj|BAF98303.1| geranylgeranyl-diphosphate synthase [Hevea brasiliensis] Length = 306 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 129 PIHCAEKIYESIRHSVLAPCTKRAPPVMCFAACELLSGFRYAA 1 PI E+IYE++R+SVLA TKRAPPVMC AACEL G R AA Sbjct: 34 PIQYPEEIYEAMRYSVLAKRTKRAPPVMCIAACELFGGNRLAA 76 >ref|XP_011045566.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Populus euphratica] Length = 345 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 129 PIHCAEKIYESIRHSVLAPCTKRAPPVMCFAACELLSGFRYAA 1 PI +KIYE++R+SVLA KRAPPVMC AACEL G R+AA Sbjct: 72 PIQYPDKIYEAMRYSVLAKGAKRAPPVMCVAACELFGGDRHAA 114 >ref|XP_010266070.1| PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Nelumbo nucifera] Length = 342 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 129 PIHCAEKIYESIRHSVLAPCTKRAPPVMCFAACELLSGFRYAA 1 PI E+IYE++R+SVLA KRAPPVMC AACEL G R+AA Sbjct: 58 PIAYPERIYEAMRYSVLAKGAKRAPPVMCVAACELFGGHRHAA 100 >ref|XP_002312936.2| geranylgeranyl pyrophosphate synthase family protein [Populus trichocarpa] gi|550331696|gb|EEE86891.2| geranylgeranyl pyrophosphate synthase family protein [Populus trichocarpa] Length = 345 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 129 PIHCAEKIYESIRHSVLAPCTKRAPPVMCFAACELLSGFRYAA 1 PI +KIYE++R+SVLA KRAPPVMC AACEL G R+AA Sbjct: 72 PIQYPDKIYEAMRYSVLAKGAKRAPPVMCVAACELFGGNRHAA 114 >ref|XP_002306207.2| hypothetical protein POPTR_0004s18610g [Populus trichocarpa] gi|550341336|gb|EEE86718.2| hypothetical protein POPTR_0004s18610g [Populus trichocarpa] Length = 347 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 129 PIHCAEKIYESIRHSVLAPCTKRAPPVMCFAACELLSGFRYAA 1 PI +KIYE++R+SVLA KRAPPVMC AACEL G R AA Sbjct: 74 PIQYPDKIYEAMRYSVLAKGAKRAPPVMCVAACELFGGNRLAA 116 >gb|AIG15450.1| geranylgeranyl diphosphate synthase 1 [Azadirachta indica] Length = 333 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 129 PIHCAEKIYESIRHSVLAPCTKRAPPVMCFAACELLSGFRYAA 1 PI E+IYE++R+SVLA KRAPPVMC AACEL G R AA Sbjct: 61 PIKYPEQIYEAMRYSVLAKGAKRAPPVMCVAACELFGGSRLAA 103