BLASTX nr result
ID: Anemarrhena21_contig00052461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00052461 (210 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009626733.1| PREDICTED: probable chlorophyll(ide) b reduc... 62 1e-07 ref|XP_009770954.1| PREDICTED: probable chlorophyll(ide) b reduc... 62 2e-07 gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum] 62 2e-07 ref|XP_006360473.1| PREDICTED: probable chlorophyll(ide) b reduc... 59 1e-06 ref|XP_010323446.1| PREDICTED: probable chlorophyll(ide) b reduc... 58 2e-06 ref|XP_004242955.1| PREDICTED: probable chlorophyll(ide) b reduc... 58 2e-06 ref|XP_011093590.1| PREDICTED: probable chlorophyll(ide) b reduc... 58 3e-06 >ref|XP_009626733.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic [Nicotiana tomentosiformis] Length = 506 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +1 Query: 79 KRRVNKLVGSVRNFVWRFSKPSLRSHGKYREAMEKLEEKLFSLA 210 K+ VNKLVG++R+ VW SKPSLR+ K+REA+EKLEE+LF LA Sbjct: 71 KKPVNKLVGAIRSAVWSCSKPSLRTENKFREAIEKLEERLFLLA 114 >ref|XP_009770954.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic [Nicotiana sylvestris] Length = 506 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +1 Query: 76 LKRRVNKLVGSVRNFVWRFSKPSLRSHGKYREAMEKLEEKLFSLA 210 +K+ +NKLVG++R+ VW SKPSLR+ K+REA+EKLEE+LF LA Sbjct: 70 IKKPMNKLVGAIRSAVWSCSKPSLRTENKFREAIEKLEERLFLLA 114 >gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum] Length = 506 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +1 Query: 76 LKRRVNKLVGSVRNFVWRFSKPSLRSHGKYREAMEKLEEKLFSLA 210 +K+ +NKLVG++R+ VW SKPSLR+ K+REA+EKLEE+LF LA Sbjct: 70 IKKPMNKLVGAIRSAVWSCSKPSLRTENKFREAIEKLEERLFLLA 114 >ref|XP_006360473.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like [Solanum tuberosum] Length = 486 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 85 RVNKLVGSVRNFVWRFSKPSLRSHGKYREAMEKLEEKLFSLA 210 +VNK VG++R+ VW SKPSLR+ K REAME LEE+LFSLA Sbjct: 53 KVNKFVGAIRSAVWSCSKPSLRTENKLREAMEMLEERLFSLA 94 >ref|XP_010323446.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic isoform X1 [Solanum lycopersicum] Length = 505 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 85 RVNKLVGSVRNFVWRFSKPSLRSHGKYREAMEKLEEKLFSLA 210 +VNKLVG++R+ VW SKPSLR+ K REAME LEE+LF LA Sbjct: 51 KVNKLVGAIRSAVWSCSKPSLRTENKLREAMEMLEERLFWLA 92 >ref|XP_004242955.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic isoform X2 [Solanum lycopersicum] Length = 484 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 85 RVNKLVGSVRNFVWRFSKPSLRSHGKYREAMEKLEEKLFSLA 210 +VNKLVG++R+ VW SKPSLR+ K REAME LEE+LF LA Sbjct: 51 KVNKLVGAIRSAVWSCSKPSLRTENKLREAMEMLEERLFWLA 92 >ref|XP_011093590.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic [Sesamum indicum] gi|747091700|ref|XP_011093591.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic [Sesamum indicum] Length = 523 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +1 Query: 88 VNKLVGSVRNFVWRFSKPSLRSHGKYREAMEKLEEKLFSLA 210 VNK +G +RN +WR SKPSLRS K EAMEKLEE LFS + Sbjct: 87 VNKFLGGIRNAIWRVSKPSLRSERKLAEAMEKLEETLFSFS 127