BLASTX nr result
ID: Anemarrhena21_contig00052359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00052359 (262 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102911.1| E3 ubiquitin-protein ligase UPL6 [Morus nota... 49 3e-06 >ref|XP_010102911.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] gi|587906299|gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] Length = 1413 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 25/57 (43%), Positives = 34/57 (59%) Frame = +1 Query: 1 PACAL*FKMLVTKKQNIQRTSVTETKIWRWISENTTKDRIRNECIWRKLDVVPIKDK 171 PA K K+Q+I + SV E ++ RW+S T DRI+NE I K+ V PI+DK Sbjct: 965 PAMLYGSKCWAIKRQHISKMSVAEMRMLRWMSGQTRMDRIKNEVIRSKVGVAPIEDK 1021 Score = 28.5 bits (62), Expect(2) = 3e-06 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 171 MRQNLLR*VGHVQQRQISAPMRKIDRIIV 257 +R+ LR GHVQ+R + AP+R + I++ Sbjct: 1022 VREGRLRWFGHVQRRPLEAPVRAWEDILI 1050