BLASTX nr result
ID: Anemarrhena21_contig00052349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00052349 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010937258.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 57 6e-06 >ref|XP_010937258.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like [Elaeis guineensis] gi|743840421|ref|XP_010937259.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like [Elaeis guineensis] Length = 1831 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/62 (53%), Positives = 36/62 (58%) Frame = +3 Query: 3 TVALPDKSSSFDRSISTIPGFTTSSVDKPQLTIDVQTSKEFVPLLTSTNSCNMETPSSTF 182 TVALPDK SS DRSIS IPGFT S+ KPQL D Q P L NS M +S + Sbjct: 664 TVALPDKPSSIDRSISIIPGFTASAAGKPQLGSDAQRPHTSDPSLELLNSEKMVKVASLY 723 Query: 183 VS 188 S Sbjct: 724 SS 725