BLASTX nr result
ID: Anemarrhena21_contig00052147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00052147 (450 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009414728.1| PREDICTED: tetratricopeptide repeat protein ... 58 3e-06 gb|EEE54662.1| hypothetical protein OsJ_01948 [Oryza sativa Japo... 39 7e-06 >ref|XP_009414728.1| PREDICTED: tetratricopeptide repeat protein 5-like [Musa acuminata subsp. malaccensis] Length = 419 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 230 MSGGVSQDSPVVVRATEAVEELYHVRDTYFPIDPEMKTSKLRT 102 MSG S ++ + RA+ A EELYH+RDTYFP D E KTSKLRT Sbjct: 1 MSGSGSDEAEAIARASAAAEELYHLRDTYFPRDSEEKTSKLRT 43 >gb|EEE54662.1| hypothetical protein OsJ_01948 [Oryza sativa Japonica Group] Length = 386 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 88 LSAFSIPYLPGPNKKILCQLSMLERKMAQ 2 ++ FS+ G +KKILCQLSMLER MAQ Sbjct: 89 MNCFSLALSKGADKKILCQLSMLERSMAQ 117 Score = 37.4 bits (85), Expect(2) = 7e-06 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -2 Query: 191 RATEAVEELYHVRDTYFPIDPEMKTSKLR 105 R +A EELY +RDT+FP DP K + LR Sbjct: 26 RTADAAEELYRLRDTFFPRDPVEKAAALR 54