BLASTX nr result
ID: Anemarrhena21_contig00052066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00052066 (204 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propioniba... 107 3e-21 gb|ABP91180.1| unknown protein [Streptococcus suis 98HAH33] gi|1... 69 1e-09 gb|EEQ24559.1| hypothetical protein LACJE0001_1464 [Lactobacillu... 67 6e-09 emb|CJI46630.1| IS1167%2C transposase [Streptococcus pneumoniae] 66 1e-08 dbj|GAN11782.1| permease, partial [Mucor ambiguus] 65 1e-08 emb|CDN41090.1| hypothetical protein BN871_AB_00880 [Paenibacill... 65 1e-08 gb|ETI87245.1| hypothetical protein Q615_SPAC00010G0001 [Strepto... 65 2e-08 gb|EPF26580.1| hypothetical protein HMPREF1221_00764, partial [T... 64 5e-08 emb|CBL51099.1| PG1 protein, homology to Homo sapiens [Lactobaci... 63 7e-08 emb|CBL49508.1| PG1 protein, homology to Homo sapiens [Lactobaci... 63 7e-08 emb|CCG06604.1| Putative uncharacterized protein, partial [Rhodo... 63 9e-08 emb|CBY13234.1| unnamed protein product [Oikopleura dioica] 62 1e-07 gb|EFH30562.1| hypothetical protein HMPREF0526_10715, partial [L... 62 2e-07 ref|WP_022187435.1| hypothetical protein [Azospirillum sp. CAG:2... 60 6e-07 >gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] Length = 113 Score = 107 bits (267), Expect = 3e-21 Identities = 49/67 (73%), Positives = 53/67 (79%) Frame = -3 Query: 202 SLPVSTARSTLSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRHLR 23 S PVS ARS LS + + PTR T YE FTPN SGQRSHPTY+RGCWHVVSRCFF+ YRH R Sbjct: 18 SQPVSKARSGLSPKITLPTRSTTYEPFTPNKSGQRSHPTYHRGCWHVVSRCFFTHYRHSR 77 Query: 22 FVPGERG 2 FV GE G Sbjct: 78 FVTGESG 84 >gb|ABP91180.1| unknown protein [Streptococcus suis 98HAH33] gi|145690754|gb|ABP91259.1| unknown protein [Streptococcus suis 98HAH33] gi|145690985|gb|ABP91490.1| unknown protein [Streptococcus suis 98HAH33] gi|145691080|gb|ABP91585.1| unknown protein [Streptococcus suis 98HAH33] Length = 186 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/45 (71%), Positives = 33/45 (73%) Frame = -3 Query: 148 TRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRHLRFVP 14 T QTA FTPN SGQRS PTYYRGCWHVVSR F RYR +R P Sbjct: 102 TYQTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVRYRQVRNFP 146 >gb|EEQ24559.1| hypothetical protein LACJE0001_1464 [Lactobacillus jensenii 269-3] Length = 174 Score = 66.6 bits (161), Expect = 6e-09 Identities = 34/59 (57%), Positives = 37/59 (62%) Frame = -3 Query: 199 LPVSTARSTLSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRHLR 23 L VS A LS S T Q+A FTPN SGQR PTYYRGCWHVVSR F YR ++ Sbjct: 42 LTVSDAVLRLSRRLSHQTYQSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIK 100 >emb|CJI46630.1| IS1167%2C transposase [Streptococcus pneumoniae] Length = 257 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/40 (75%), Positives = 30/40 (75%) Frame = -3 Query: 148 TRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRH 29 T TA FTPN SGQRS PTYYRGCWHVVSR F RYRH Sbjct: 173 TYLTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVRYRH 212 >dbj|GAN11782.1| permease, partial [Mucor ambiguus] Length = 181 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -3 Query: 139 TAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRH 29 TA FTPNNSGQR PTYYRGCWHVVSR F RYRH Sbjct: 2 TACARFTPNNSGQRLPPTYYRGCWHVVSRGFLLRYRH 38 >emb|CDN41090.1| hypothetical protein BN871_AB_00880 [Paenibacillus sp. P22] Length = 217 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = -3 Query: 172 LSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRH 29 LS + T + A FTPNNSGQR PTYYRGCWHVVS+ F RYRH Sbjct: 94 LSPKIKHRTYKAACARFTPNNSGQRLPPTYYRGCWHVVSQGFLLRYRH 141 >gb|ETI87245.1| hypothetical protein Q615_SPAC00010G0001 [Streptococcus anginosus DORA_7] Length = 186 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/48 (66%), Positives = 33/48 (68%) Frame = -3 Query: 172 LSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRH 29 LS S T TA FTPN SGQRS PTYYRGCWHVVSR F +YRH Sbjct: 94 LSHCLSLQTFLTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVKYRH 141 >gb|EPF26580.1| hypothetical protein HMPREF1221_00764, partial [Treponema socranskii subsp. paredis ATCC 35535] Length = 235 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/58 (55%), Positives = 34/58 (58%) Frame = -3 Query: 202 SLPVSTARSTLSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRH 29 S PV LS S + A FTPNNS QRSH T YRGCWHV+SRC F YRH Sbjct: 37 SSPVLNIAPELSPGISYQAWRPACMPFTPNNSEQRSHLTCYRGCWHVISRCLFLPYRH 94 >emb|CBL51099.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] Length = 144 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/57 (56%), Positives = 35/57 (61%) Frame = -3 Query: 193 VSTARSTLSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRHLR 23 VS A LS S T +A FTPN SGQR PTYYRGCWHVVSR F YR ++ Sbjct: 14 VSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIK 70 >emb|CBL49508.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|295030408|emb|CBL49887.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|295030420|emb|CBL49899.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] Length = 144 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/57 (56%), Positives = 35/57 (61%) Frame = -3 Query: 193 VSTARSTLSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRHLR 23 VS A LS S T +A FTPN SGQR PTYYRGCWHVVSR F YR ++ Sbjct: 14 VSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIK 70 >emb|CCG06604.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 104 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/55 (60%), Positives = 36/55 (65%) Frame = -3 Query: 193 VSTARSTLSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRH 29 VS A LS S T TAY LFTP++S QR P+YYRGCWH VSR FF YRH Sbjct: 2 VSKAFPGLSPGLSPLTDLTAYALFTPSDSEQRLPPSYYRGCWHEVSRGFFWCYRH 56 >emb|CBY13234.1| unnamed protein product [Oikopleura dioica] Length = 210 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/56 (57%), Positives = 36/56 (64%) Frame = -3 Query: 202 SLPVSTARSTLSVEFSRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRY 35 S+ VS A LS SR T AY FTP++S QRS P+YYRGCWH VSR F RY Sbjct: 29 SMAVSDAVPGLSPGISRLTYHAAYAPFTPSDSEQRSGPSYYRGCWHEVSRPFLFRY 84 >gb|EFH30562.1| hypothetical protein HMPREF0526_10715, partial [Lactobacillus jensenii JV-V16] Length = 120 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -3 Query: 157 SRPTRQTAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRHLR 23 S T Q+A FTPN SGQR PTYYRGCWHVVSR F YR ++ Sbjct: 2 SHQTYQSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIK 46 >ref|WP_022187435.1| hypothetical protein [Azospirillum sp. CAG:260] gi|524390510|emb|CDB39267.1| putative uncharacterized protein [Azospirillum sp. CAG:260] Length = 146 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -3 Query: 139 TAYELFTPNNSGQRSHPTYYRGCWHVVSRCFFSRYRHLR 23 TAY FTP+NS QR P+YYRGCWH VSR FF YRH R Sbjct: 62 TAYTPFTPSNSEQRLPPSYYRGCWHEVSRGFFRCYRHHR 100