BLASTX nr result
ID: Anemarrhena21_contig00051616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00051616 (691 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050185.1| Uncharacterized protein isoform 1 [Theobroma... 60 1e-06 >ref|XP_007050185.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508702446|gb|EOX94342.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 557 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -3 Query: 560 VRQMVWKLRSQWRQVTRSKQSRMQFRYDPESYSQNFDDGHFH 435 ++Q VWKL+SQWRQ R ++S MQF YD SYS NFDDG H Sbjct: 507 LKQFVWKLKSQWRQALRLQRSSMQFSYDLHSYSLNFDDGFTH 548