BLASTX nr result
ID: Anemarrhena21_contig00051239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00051239 (435 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009398514.1| PREDICTED: cationic amino acid transporter 2... 85 2e-14 ref|XP_009388995.1| PREDICTED: cationic amino acid transporter 2... 84 3e-14 ref|XP_008791390.1| PREDICTED: cationic amino acid transporter 3... 84 5e-14 gb|KDO66060.1| hypothetical protein CISIN_1g006102mg [Citrus sin... 83 6e-14 gb|KDO66059.1| hypothetical protein CISIN_1g006102mg [Citrus sin... 83 6e-14 ref|XP_006443501.1| hypothetical protein CICLE_v10019203mg [Citr... 83 6e-14 ref|XP_011001711.1| PREDICTED: cationic amino acid transporter 4... 82 2e-13 ref|XP_012698366.1| PREDICTED: cationic amino acid transporter 2... 81 2e-13 ref|XP_010909913.1| PREDICTED: cationic amino acid transporter 2... 81 2e-13 ref|XP_002464148.1| hypothetical protein SORBIDRAFT_01g013100 [S... 81 2e-13 gb|KJB44491.1| hypothetical protein B456_007G255700 [Gossypium r... 81 3e-13 ref|XP_012492462.1| PREDICTED: cationic amino acid transporter 2... 81 3e-13 ref|XP_002325437.2| hypothetical protein POPTR_0019s05610g [Popu... 80 5e-13 ref|XP_011034289.1| PREDICTED: cationic amino acid transporter 2... 80 7e-13 ref|XP_011034288.1| PREDICTED: cationic amino acid transporter 2... 80 7e-13 ref|XP_002319189.1| cationic amino acid transporter 3 family pro... 80 7e-13 ref|XP_011001714.1| PREDICTED: cationic amino acid transporter 2... 79 9e-13 gb|KHG19285.1| Cationic amino acid transporter 4, vacuolar -like... 79 9e-13 ref|XP_010243744.1| PREDICTED: cationic amino acid transporter 2... 79 9e-13 ref|XP_008665175.1| PREDICTED: cationic amino acid transporter 2... 79 9e-13 >ref|XP_009398514.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Musa acuminata subsp. malaccensis] Length = 636 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 A TW +VS+WL+IGVLVY+FYGRTHSSLTDV+YVP+AH +EIYRTS Sbjct: 586 AGTWFRVSMWLLIGVLVYLFYGRTHSSLTDVVYVPAAHAEEIYRTS 631 >ref|XP_009388995.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Musa acuminata subsp. malaccensis] Length = 641 Score = 84.3 bits (207), Expect = 3e-14 Identities = 35/46 (76%), Positives = 44/46 (95%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 A TW++VS WL++GVLVY+FYGR+HSSLTDV+YVP+AHVDEIY+TS Sbjct: 592 AGTWLRVSSWLLVGVLVYLFYGRSHSSLTDVVYVPAAHVDEIYKTS 637 >ref|XP_008791390.1| PREDICTED: cationic amino acid transporter 3, mitochondrial-like isoform X1 [Phoenix dactylifera] Length = 640 Score = 83.6 bits (205), Expect = 5e-14 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 A TW++VSIWL+IGV VY+FYGRTHSSLTD +YVP AH DEIYRTS Sbjct: 590 AGTWIRVSIWLMIGVFVYLFYGRTHSSLTDAVYVPVAHADEIYRTS 635 >gb|KDO66060.1| hypothetical protein CISIN_1g006102mg [Citrus sinensis] Length = 505 Score = 83.2 bits (204), Expect = 6e-14 Identities = 34/46 (73%), Positives = 43/46 (93%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 ++TW +VS+WL+IGVLVY+FYGRTHSSL D +YVP+AHVDEIYR+S Sbjct: 438 SATWARVSVWLIIGVLVYVFYGRTHSSLLDAVYVPAAHVDEIYRSS 483 >gb|KDO66059.1| hypothetical protein CISIN_1g006102mg [Citrus sinensis] Length = 661 Score = 83.2 bits (204), Expect = 6e-14 Identities = 34/46 (73%), Positives = 43/46 (93%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 ++TW +VS+WL+IGVLVY+FYGRTHSSL D +YVP+AHVDEIYR+S Sbjct: 594 SATWARVSVWLIIGVLVYVFYGRTHSSLLDAVYVPAAHVDEIYRSS 639 >ref|XP_006443501.1| hypothetical protein CICLE_v10019203mg [Citrus clementina] gi|568850985|ref|XP_006479175.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Citrus sinensis] gi|557545763|gb|ESR56741.1| hypothetical protein CICLE_v10019203mg [Citrus clementina] Length = 661 Score = 83.2 bits (204), Expect = 6e-14 Identities = 34/46 (73%), Positives = 43/46 (93%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 ++TW +VS+WL+IGVLVY+FYGRTHSSL D +YVP+AHVDEIYR+S Sbjct: 594 SATWARVSVWLIIGVLVYVFYGRTHSSLLDAVYVPAAHVDEIYRSS 639 >ref|XP_011001711.1| PREDICTED: cationic amino acid transporter 4, vacuolar isoform X1 [Populus euphratica] Length = 643 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSS 174 A TW +VSIWL+IG LVY+FYGRTHSSL + +YVP+AH DEIYRTSS Sbjct: 593 AGTWFRVSIWLLIGALVYLFYGRTHSSLKNAVYVPTAHADEIYRTSS 639 >ref|XP_012698366.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Setaria italica] Length = 1128 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +1 Query: 40 TWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSS 174 TWM+V IWL++GVLVYIFYGRTHSSLTDV+Y+P A DEIYR+SS Sbjct: 1080 TWMRVGIWLLMGVLVYIFYGRTHSSLTDVVYIPVAQADEIYRSSS 1124 >ref|XP_010909913.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Elaeis guineensis] Length = 649 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 A TW++VSIWLVIGV VY+ YGRTHSSLT V+YVP AH DEIYRTS Sbjct: 599 AGTWIRVSIWLVIGVFVYLLYGRTHSSLTGVVYVPVAHADEIYRTS 644 >ref|XP_002464148.1| hypothetical protein SORBIDRAFT_01g013100 [Sorghum bicolor] gi|241918002|gb|EER91146.1| hypothetical protein SORBIDRAFT_01g013100 [Sorghum bicolor] Length = 635 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +1 Query: 40 TWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSS 174 TWM+V IWL++GVLVY+FYGRTHSSLTDV+YVP A DEIYR+SS Sbjct: 587 TWMRVGIWLLMGVLVYVFYGRTHSSLTDVVYVPVAQADEIYRSSS 631 >gb|KJB44491.1| hypothetical protein B456_007G255700 [Gossypium raimondii] Length = 640 Score = 80.9 bits (198), Expect = 3e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 A+TW +VS+WL+IGV+VY+FYGR+HSSL D +YVP+AHVDEIYR+S Sbjct: 590 AATWARVSVWLLIGVVVYVFYGRSHSSLLDAVYVPAAHVDEIYRSS 635 >ref|XP_012492462.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Gossypium raimondii] gi|763777367|gb|KJB44490.1| hypothetical protein B456_007G255700 [Gossypium raimondii] Length = 642 Score = 80.9 bits (198), Expect = 3e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 A+TW +VS+WL+IGV+VY+FYGR+HSSL D +YVP+AHVDEIYR+S Sbjct: 592 AATWARVSVWLLIGVVVYVFYGRSHSSLLDAVYVPAAHVDEIYRSS 637 >ref|XP_002325437.2| hypothetical protein POPTR_0019s05610g [Populus trichocarpa] gi|550316879|gb|EEE99818.2| hypothetical protein POPTR_0019s05610g [Populus trichocarpa] Length = 643 Score = 80.1 bits (196), Expect = 5e-13 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSS 174 A TW +VSIWL+IG LVY+FYGRTHSSL + +YVP+AH +EIYRTSS Sbjct: 593 AGTWFRVSIWLLIGALVYLFYGRTHSSLKNAVYVPTAHAEEIYRTSS 639 >ref|XP_011034289.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X2 [Populus euphratica] Length = 587 Score = 79.7 bits (195), Expect = 7e-13 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSSRT 180 A+TW +VS+WL++GVLVY FYGRTHSSL D +YVP+ H DEIYR+S + Sbjct: 537 AATWTRVSVWLIVGVLVYTFYGRTHSSLLDAVYVPATHADEIYRSSGES 585 >ref|XP_011034288.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X1 [Populus euphratica] Length = 640 Score = 79.7 bits (195), Expect = 7e-13 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSSRT 180 A+TW +VS+WL++GVLVY FYGRTHSSL D +YVP+ H DEIYR+S + Sbjct: 590 AATWTRVSVWLIVGVLVYTFYGRTHSSLLDAVYVPATHADEIYRSSGES 638 >ref|XP_002319189.1| cationic amino acid transporter 3 family protein [Populus trichocarpa] gi|222857565|gb|EEE95112.1| cationic amino acid transporter 3 family protein [Populus trichocarpa] Length = 640 Score = 79.7 bits (195), Expect = 7e-13 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSSRT 180 A+TW +VS+WL++GVLVY FYGRTHSSL D +YVP+ H DEIYR+S + Sbjct: 590 AATWTRVSVWLIVGVLVYTFYGRTHSSLLDAVYVPATHADEIYRSSGES 638 >ref|XP_011001714.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Populus euphratica] Length = 641 Score = 79.3 bits (194), Expect = 9e-13 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSSRT 180 A+TW +VS+WL++GVLVY+FYGR HSSL D +YVP++H DEIYR+S + Sbjct: 591 AATWTRVSVWLIVGVLVYVFYGRRHSSLLDAVYVPASHADEIYRSSGES 639 >gb|KHG19285.1| Cationic amino acid transporter 4, vacuolar -like protein [Gossypium arboreum] Length = 704 Score = 79.3 bits (194), Expect = 9e-13 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTS 171 A+TW +VS+WL+IGV+VY+FYGR+HSSL D +YVP+AH DEIYR+S Sbjct: 654 AATWARVSVWLLIGVVVYVFYGRSHSSLLDAVYVPAAHADEIYRSS 699 >ref|XP_010243744.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Nelumbo nucifera] Length = 637 Score = 79.3 bits (194), Expect = 9e-13 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +1 Query: 34 ASTWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSS 174 ASTW +VSIWL+ GVL+YIFYGRTHSSL + IYVP+ H +EIYR+SS Sbjct: 587 ASTWFRVSIWLIAGVLIYIFYGRTHSSLQNAIYVPTTHANEIYRSSS 633 >ref|XP_008665175.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X3 [Zea mays] Length = 545 Score = 79.3 bits (194), Expect = 9e-13 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 40 TWMKVSIWLVIGVLVYIFYGRTHSSLTDVIYVPSAHVDEIYRTSS 174 TWM+V IWL++GVL+YIFYGRTHSSLTDV+YVP A DE+YR+SS Sbjct: 497 TWMRVGIWLLMGVLLYIFYGRTHSSLTDVVYVPVAQADEMYRSSS 541