BLASTX nr result
ID: Anemarrhena21_contig00051218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00051218 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17738.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_012494012.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 60 4e-07 ref|XP_009623932.1| PREDICTED: protein jagged-1-like [Nicotiana ... 60 6e-07 emb|CDN96898.1| putative Ty-1 copia retrotransposon [Phaseolus v... 60 6e-07 gb|AER13159.1| putative Ty-1 copia retrotransposon [Phaseolus vu... 60 6e-07 ref|XP_008694572.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 60 7e-07 gb|AAR13295.1| retrovirus-related pol polyprotein [Phaseolus vul... 59 1e-06 gb|AII72209.1| gag protein [Reticuloendotheliosis virus] 58 2e-06 gb|AGV92858.1| gag protein [Duck infectious anemia virus] 58 2e-06 gb|AII72212.1| gag protein [Reticuloendotheliosis virus] 56 8e-06 gb|ACJ65652.1| gag protein [Reticuloendotheliosis virus] gi|2153... 56 8e-06 ref|YP_223870.1| gag protein [Reticuloendotheliosis virus] gi|57... 56 8e-06 gb|AAA63525.1| gag protein, partial [Spleen necrosis virus] 56 8e-06 gb|AAC58239.1| gag [Fowlpox virus] 56 8e-06 gb|AAO62318.1| gag protein [Fowlpox virus] 56 8e-06 gb|AAZ57417.1| gag protein [Reticuloendotheliosis virus] 56 8e-06 gb|AHC55378.1| gag protein [Reticuloendotheliosis virus] 56 8e-06 gb|AGS83374.1| gag protein [Reticuloendotheliosis virus] 56 8e-06 gb|AFV95353.1| gag protein [Reticuloendotheliosis virus] 56 8e-06 gb|ACT75573.1| gag protein [Reticuloendotheliosis virus] 56 8e-06 >emb|CDP17738.1| unnamed protein product [Coffea canephora] Length = 798 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +1 Query: 64 RGRSSNQKSSENQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKLQNKNK 213 RGR Q+S RR KS SR+ K++CAFC+E GHWKKDCPKL+ K K Sbjct: 231 RGR---QQSQSKGRRGWSKSISRVAKDECAFCREKGHWKKDCPKLKKKGK 277 >ref|XP_012494012.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105805629 [Propithecus coquereli] Length = 1708 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = +1 Query: 67 GRSSNQKSSENQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKLQNK 207 G + Q+ + ++ ++ LG NQCA+CKE+GHWKKDCPKLQNK Sbjct: 451 GENRPQQKGKGKKTDNPGNKPPLGPNQCAYCKEDGHWKKDCPKLQNK 497 >ref|XP_009623932.1| PREDICTED: protein jagged-1-like [Nicotiana tomentosiformis] Length = 379 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +1 Query: 64 RGRSSNQKSSENQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKLQNK 207 R R NQ + ++ R SRSR KN+CAFC++ GHWKKDCPKL+NK Sbjct: 67 RVRPQNQTRT---KKGRSNSRSRPSKNECAFCRKKGHWKKDCPKLKNK 111 >emb|CDN96898.1| putative Ty-1 copia retrotransposon [Phaseolus vulgaris] Length = 813 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +1 Query: 64 RGRSSNQKSSENQRRPRYKSRSRL-GKNQCAFCKENGHWKKDCPKLQNKNK 213 RGR Q+S +RR KS+ R+ K++CAFC E GHWKKDCPKLQ K K Sbjct: 144 RGR---QQSQTKERRGMSKSKGRVVAKDECAFCHEKGHWKKDCPKLQKKEK 191 >gb|AER13159.1| putative Ty-1 copia retrotransposon [Phaseolus vulgaris] Length = 867 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +1 Query: 64 RGRSSNQKSSENQRRPRYKSRSR-LGKNQCAFCKENGHWKKDCPKLQNKNK 213 RGR Q+S +RR KS+ R + K++CAFC E GHWKKDCPKLQ K K Sbjct: 145 RGR---QQSQTKERRGMSKSKGRAVAKDECAFCHEKGHWKKDCPKLQKKEK 192 >ref|XP_008694572.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103668077 [Ursus maritimus] Length = 1274 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKLQNKNK 213 NQ+ PR LGKNQCA+CKE GHW KDCPK +NKNK Sbjct: 217 NQKGPRLP----LGKNQCAYCKEQGHWVKDCPKKKNKNK 251 >gb|AAR13295.1| retrovirus-related pol polyprotein [Phaseolus vulgaris] Length = 324 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +1 Query: 82 QKSSENQRRPRYKSRSRL-GKNQCAFCKENGHWKKDCPKLQNKNK 213 Q+S +RR KS+ R+ K++CAFC E GHWKKDCPKLQ K K Sbjct: 187 QQSQTKERRGMCKSKGRVVAKDECAFCHEKGHWKKDCPKLQKKEK 231 >gb|AII72209.1| gag protein [Reticuloendotheliosis virus] Length = 499 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 N++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 NKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|AGV92858.1| gag protein [Duck infectious anemia virus] Length = 499 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K RS LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRSPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|AII72212.1| gag protein [Reticuloendotheliosis virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|ACJ65652.1| gag protein [Reticuloendotheliosis virus] gi|215398755|gb|ACJ65655.1| gag protein [Reticuloendotheliosis virus] gi|329299184|gb|AEB80487.1| gag protein [Reticuloendotheliosis virus] gi|485073382|gb|AGK65048.1| gag protein [Reticuloendotheliosis virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >ref|YP_223870.1| gag protein [Reticuloendotheliosis virus] gi|57865345|gb|AAW57299.1| gag protein [Reticuloendotheliosis virus] Length = 500 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 454 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 487 >gb|AAA63525.1| gag protein, partial [Spleen necrosis virus] Length = 179 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 11 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 44 >gb|AAC58239.1| gag [Fowlpox virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|AAO62318.1| gag protein [Fowlpox virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|AAZ57417.1| gag protein [Reticuloendotheliosis virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|AHC55378.1| gag protein [Reticuloendotheliosis virus] Length = 491 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 445 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 478 >gb|AGS83374.1| gag protein [Reticuloendotheliosis virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|AFV95353.1| gag protein [Reticuloendotheliosis virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486 >gb|ACT75573.1| gag protein [Reticuloendotheliosis virus] Length = 499 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 97 NQRRPRYKSRSRLGKNQCAFCKENGHWKKDCPKL 198 +++ P K R LGKNQCA+CKE GHWKK+CPKL Sbjct: 453 SKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKL 486