BLASTX nr result
ID: Anemarrhena21_contig00050277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00050277 (277 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malayi] 65 1e-08 ref|XP_001892989.1| hypothetical protein Bm1_07595 [Brugia malay... 58 1e-07 emb|CDP91803.1| Protein Bm210 [Brugia malayi] 58 3e-06 ref|XP_001893677.1| hypothetical protein Bm1_11030 [Brugia malayi] 58 3e-06 gb|KGG51869.1| hypothetical protein DI09_258p10 [Mitosporidium d... 56 8e-06 >ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malayi] Length = 62 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/60 (58%), Positives = 38/60 (63%) Frame = -3 Query: 275 VICAPAAVLRHGSRXXXXXXXXXXXXXVTRDNHGSPLHYHRKLIRQILERYVVGTRPYDQ 96 VICAPAA L GSR VTR NHG ++YHRKLIRQ L+RYV GTRP DQ Sbjct: 2 VICAPAAFLGCGSRFSGSLSGVEPLFSVTRYNHGRHINYHRKLIRQTLDRYVAGTRPCDQ 61 >ref|XP_001892989.1| hypothetical protein Bm1_07595 [Brugia malayi] gi|170583594|ref|XP_001896653.1| hypothetical protein Bm1_25975 [Brugia malayi] Length = 128 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 95 ADRMVLYRRRIFQVSALSTFDGSVVDYHGCH 187 ADRMVLYRRRI+QVSALSTFDGS+ YHGC+ Sbjct: 2 ADRMVLYRRRIYQVSALSTFDGSLCAYHGCN 32 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +1 Query: 223 ELETRLPCLRTAAGAQIT 276 E E RLP R AAGAQIT Sbjct: 34 EPEKRLPHPRKAAGAQIT 51 >emb|CDP91803.1| Protein Bm210 [Brugia malayi] Length = 128 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 95 ADRMVLYRRRIFQVSALSTFDGSVVDYHGCH 187 ADRMVLYRRRI+QVSALSTFDGS+ YHGC+ Sbjct: 2 ADRMVLYRRRIYQVSALSTFDGSLCAYHGCN 32 >ref|XP_001893677.1| hypothetical protein Bm1_11030 [Brugia malayi] Length = 114 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 95 ADRMVLYRRRIFQVSALSTFDGSVVDYHGCH 187 ADRMVLYRRRI+QVSALSTFDGS+ YHGC+ Sbjct: 2 ADRMVLYRRRIYQVSALSTFDGSLCAYHGCN 32 >gb|KGG51869.1| hypothetical protein DI09_258p10 [Mitosporidium daphniae] Length = 263 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/64 (46%), Positives = 38/64 (59%) Frame = +2 Query: 86 SN*ADRMVLYRRRIFQVSALSTFDGSVVDYHGCHXXXXXXXXXXXXXXXHGYHV*GQQQA 265 +N +DRM RRR Q+SALSTFDG + YHG + +GYH+ G+QQA Sbjct: 26 NNFSDRMTTCRRRTIQISALSTFDGRIEAYHGSN-----GVRFRRGSLRNGYHIQGRQQA 80 Query: 266 RKLP 277 RKLP Sbjct: 81 RKLP 84