BLASTX nr result
ID: Anemarrhena21_contig00049679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00049679 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008792631.1| PREDICTED: uncharacterized protein LOC103709... 57 6e-06 >ref|XP_008792631.1| PREDICTED: uncharacterized protein LOC103709182 [Phoenix dactylifera] Length = 1282 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/65 (46%), Positives = 36/65 (55%) Frame = -2 Query: 195 LLENSLCHLLKCAEKLFSEPVTGKSHNPPSRSQQKRETARRQNRKHGETLSSASGPTIGG 16 L +NSL HLL CA+KLF E V + PS+S K + A R+ K L S PT G Sbjct: 905 LFDNSLKHLLNCADKLFCESVNENYSDQPSKSNHKEKVAVRRKSKRKAALDGTSIPTKGA 964 Query: 15 EAKTD 1 E KTD Sbjct: 965 ELKTD 969