BLASTX nr result
ID: Anemarrhena21_contig00049656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00049656 (381 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274366.2| PREDICTED: ferredoxin--NADP reductase, leaf-... 117 3e-24 ref|XP_010268658.1| PREDICTED: ferredoxin--NADP reductase, leaf ... 115 1e-23 ref|XP_010029673.1| PREDICTED: ferredoxin--NADP reductase, leaf ... 114 2e-23 gb|KCW56622.1| hypothetical protein EUGRSUZ_I02340 [Eucalyptus g... 114 2e-23 emb|CAN80512.1| hypothetical protein VITISV_043591 [Vitis vinifera] 114 2e-23 emb|CAB71293.1| chloroplast ferredoxin-NADP+ oxidoreductase prec... 112 9e-23 ref|XP_010920179.1| PREDICTED: ferredoxin--NADP reductase, leaf ... 112 1e-22 ref|XP_002265774.1| PREDICTED: ferredoxin--NADP reductase, leaf-... 111 2e-22 emb|CAN59785.1| hypothetical protein VITISV_042164 [Vitis vinifera] 111 2e-22 gb|AAX57358.1| putative ferredoxin-NADP reductase, partial [Sola... 111 2e-22 gb|AAX57356.1| putative ferredoxin-NADP reductase, partial [Sola... 111 2e-22 ref|XP_007017817.1| Ferredoxin-NADP(+)-oxidoreductase 1, putativ... 111 2e-22 gb|AAZ85313.1| putative ferredoxin NADP reductase, partial [Sola... 110 5e-22 ref|XP_006340740.1| PREDICTED: ferredoxin--NADP reductase, leaf-... 110 5e-22 sp|O04977.1|FENR1_TOBAC RecName: Full=Ferredoxin--NADP reductase... 110 5e-22 ref|XP_011099850.1| PREDICTED: ferredoxin--NADP reductase, leaf-... 109 6e-22 ref|XP_009794242.1| PREDICTED: ferredoxin--NADP reductase, leaf-... 109 8e-22 ref|XP_009413066.1| PREDICTED: ferredoxin--NADP reductase, leaf ... 109 8e-22 ref|XP_009588213.1| PREDICTED: ferredoxin--NADP reductase, leaf-... 108 1e-21 gb|AAZ85322.1| putative ferredoxin NADP reductase, partial [Sola... 108 1e-21 >ref|XP_002274366.2| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic [Vitis vinifera] gi|302142677|emb|CBI19880.3| unnamed protein product [Vitis vinifera] Length = 363 Score = 117 bits (293), Expect = 3e-24 Identities = 59/70 (84%), Positives = 64/70 (91%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LYSRNVC G K VV I+AQVTTEAPAKVEKVSKKN+EGVVVNKF+PKNPYIG+CL Sbjct: 34 FNKCFLYSRNVCVGRK-VVTIKAQVTTEAPAKVEKVSKKNDEGVVVNKFRPKNPYIGKCL 92 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 93 LNTKITGDDA 102 >ref|XP_010268658.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic [Nelumbo nucifera] Length = 365 Score = 115 bits (287), Expect = 1e-23 Identities = 59/70 (84%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F KTCLY RNV G+ VV IRAQVTTEAPAKVEK+SKKNEE VVVNKFKPKNPY GRCL Sbjct: 36 FSKTCLYYRNVSIRGR-VVSIRAQVTTEAPAKVEKISKKNEEDVVVNKFKPKNPYTGRCL 94 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 95 LNTKITGDDA 104 >ref|XP_010029673.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic [Eucalyptus grandis] gi|629090370|gb|KCW56623.1| hypothetical protein EUGRSUZ_I02340 [Eucalyptus grandis] Length = 365 Score = 114 bits (285), Expect = 2e-23 Identities = 56/70 (80%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F K ++ R+VCGGG+MV IRAQVTTEAPAKV K SKK +EGVVVNKFKPKNPYIGRCL Sbjct: 35 FKKVPVHYRDVCGGGRMVSAIRAQVTTEAPAKVVKESKKMDEGVVVNKFKPKNPYIGRCL 94 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 95 LNTKITGDDA 104 >gb|KCW56622.1| hypothetical protein EUGRSUZ_I02340 [Eucalyptus grandis] Length = 338 Score = 114 bits (285), Expect = 2e-23 Identities = 56/70 (80%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F K ++ R+VCGGG+MV IRAQVTTEAPAKV K SKK +EGVVVNKFKPKNPYIGRCL Sbjct: 35 FKKVPVHYRDVCGGGRMVSAIRAQVTTEAPAKVVKESKKMDEGVVVNKFKPKNPYIGRCL 94 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 95 LNTKITGDDA 104 >emb|CAN80512.1| hypothetical protein VITISV_043591 [Vitis vinifera] Length = 598 Score = 114 bits (285), Expect = 2e-23 Identities = 59/70 (84%), Positives = 63/70 (90%), Gaps = 1/70 (1%) Frame = -2 Query: 209 HKTC-LYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 H C LYSRNVC G K VV I+AQVTTEAPAKVEKVSKKN+EGVVVNKF+PKNPYIG+CL Sbjct: 24 HIICFLYSRNVCVGRK-VVTIKAQVTTEAPAKVEKVSKKNDEGVVVNKFRPKNPYIGKCL 82 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 83 LNTKITGDDA 92 >emb|CAB71293.1| chloroplast ferredoxin-NADP+ oxidoreductase precursor [Capsicum annuum] Length = 362 Score = 112 bits (280), Expect = 9e-23 Identities = 56/70 (80%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV GG K+V IRAQVTTEAPAKVEK+SKK +EGVVVNKF+PK PYIGRCL Sbjct: 33 FNKVPLYYRNVSGGSKLVT-IRAQVTTEAPAKVEKISKKQDEGVVVNKFRPKEPYIGRCL 91 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 92 LNTKITGDDA 101 >ref|XP_010920179.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic [Elaeis guineensis] Length = 366 Score = 112 bits (279), Expect = 1e-22 Identities = 54/69 (78%), Positives = 61/69 (88%) Frame = -2 Query: 209 HKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCLL 30 HKTCL+ R+V GK+V IRAQVTTE PAKV+K+SKKN+EGVVVNK+KPK PYIGRCLL Sbjct: 38 HKTCLHPRSVSTAGKLV-SIRAQVTTETPAKVQKISKKNDEGVVVNKYKPKEPYIGRCLL 96 Query: 29 NTKITGDDA 3 NTKITGDDA Sbjct: 97 NTKITGDDA 105 >ref|XP_002265774.1| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic [Vitis vinifera] gi|297735008|emb|CBI17370.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 111 bits (278), Expect = 2e-22 Identities = 55/68 (80%), Positives = 61/68 (89%) Frame = -2 Query: 206 KTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCLLN 27 K L+ R++ GG+ VV IRAQVTTEAPAKVEK+SKKNEEGV+VNKFKPKNPYIGRCLLN Sbjct: 35 KVPLFYRDISAGGR-VVSIRAQVTTEAPAKVEKISKKNEEGVIVNKFKPKNPYIGRCLLN 93 Query: 26 TKITGDDA 3 TKITGDDA Sbjct: 94 TKITGDDA 101 >emb|CAN59785.1| hypothetical protein VITISV_042164 [Vitis vinifera] Length = 362 Score = 111 bits (278), Expect = 2e-22 Identities = 55/68 (80%), Positives = 61/68 (89%) Frame = -2 Query: 206 KTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCLLN 27 K L+ R++ GG+ VV IRAQVTTEAPAKVEK+SKKNEEGV+VNKFKPKNPYIGRCLLN Sbjct: 35 KVPLFYRDISAGGR-VVSIRAQVTTEAPAKVEKISKKNEEGVIVNKFKPKNPYIGRCLLN 93 Query: 26 TKITGDDA 3 TKITGDDA Sbjct: 94 TKITGDDA 101 >gb|AAX57358.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969084|gb|AAX57359.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969086|gb|AAX57360.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969088|gb|AAX57361.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969094|gb|AAX57364.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969096|gb|AAX57365.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969098|gb|AAX57366.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969100|gb|AAX57367.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969102|gb|AAX57368.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969104|gb|AAX57369.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969106|gb|AAX57370.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969108|gb|AAX57371.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969110|gb|AAX57372.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|61969112|gb|AAX57373.1| putative ferredoxin-NADP reductase, partial [Solanum chilense] gi|73808628|gb|AAZ85314.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] gi|73808630|gb|AAZ85315.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] gi|73808632|gb|AAZ85316.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] gi|73808634|gb|AAZ85317.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] gi|73808636|gb|AAZ85318.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] gi|73808638|gb|AAZ85319.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] gi|73808640|gb|AAZ85320.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] gi|73808642|gb|AAZ85321.1| putative ferredoxin NADP reductase, partial [Solanum chmielewskii] Length = 314 Score = 111 bits (277), Expect = 2e-22 Identities = 54/70 (77%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV GG ++V IRAQVTTEAPAKVEK+SKK EEGV+VNKF+PK PY+GRCL Sbjct: 4 FNKVPLYYRNVSGGSRLV-SIRAQVTTEAPAKVEKISKKQEEGVIVNKFRPKEPYVGRCL 62 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 63 LNTKITGDDA 72 >gb|AAX57356.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969080|gb|AAX57357.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969090|gb|AAX57362.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969092|gb|AAX57363.1| putative ferredoxin-NADP reductase, partial [Solanum peruvianum] gi|61969114|gb|AAX57374.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] gi|61969116|gb|AAX57375.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] gi|61969118|gb|AAX57376.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] gi|61969120|gb|AAX57377.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] gi|61969122|gb|AAX57378.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] gi|61969124|gb|AAX57379.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] gi|61969126|gb|AAX57380.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] gi|61969128|gb|AAX57381.1| putative ferredoxin-NADP reductase, partial [Solanum habrochaites] Length = 314 Score = 111 bits (277), Expect = 2e-22 Identities = 54/70 (77%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV GG ++V IRAQVTTEAPAKVEK+SKK EEGV+VNKF+PK PY+GRCL Sbjct: 4 FNKVPLYYRNVSGGSRLV-SIRAQVTTEAPAKVEKISKKQEEGVIVNKFRPKEPYVGRCL 62 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 63 LNTKITGDDA 72 >ref|XP_007017817.1| Ferredoxin-NADP(+)-oxidoreductase 1, putative isoform 1 [Theobroma cacao] gi|590594319|ref|XP_007017818.1| Ferredoxin-NADP(+)-oxidoreductase 1, putative isoform 1 [Theobroma cacao] gi|508723145|gb|EOY15042.1| Ferredoxin-NADP(+)-oxidoreductase 1, putative isoform 1 [Theobroma cacao] gi|508723146|gb|EOY15043.1| Ferredoxin-NADP(+)-oxidoreductase 1, putative isoform 1 [Theobroma cacao] Length = 234 Score = 111 bits (277), Expect = 2e-22 Identities = 56/70 (80%), Positives = 62/70 (88%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K+ YSRNV GG VV I+AQVTTEAPAKV KVSKK++EGVVVNKFKPKNPYIG+CL Sbjct: 33 FNKSVWYSRNVSAGGN-VVSIKAQVTTEAPAKVVKVSKKDDEGVVVNKFKPKNPYIGKCL 91 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 92 LNTKITGDDA 101 >gb|AAZ85313.1| putative ferredoxin NADP reductase, partial [Solanum ochranthum] Length = 314 Score = 110 bits (274), Expect = 5e-22 Identities = 53/70 (75%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV GG ++V IRAQVTTEAPAKVEK+SKK +EGV+VNKF+PK PY+GRCL Sbjct: 4 FNKVPLYYRNVSGGSRLV-SIRAQVTTEAPAKVEKISKKQDEGVIVNKFRPKEPYVGRCL 62 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 63 LNTKITGDDA 72 >ref|XP_006340740.1| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic-like [Solanum tuberosum] Length = 362 Score = 110 bits (274), Expect = 5e-22 Identities = 53/70 (75%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV GG ++V IRAQVTTEAPAKVEK+SKK +EGV+VNKF+PK PY+GRCL Sbjct: 33 FNKVPLYYRNVSGGSRLV-SIRAQVTTEAPAKVEKISKKQDEGVIVNKFRPKEPYVGRCL 91 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 92 LNTKITGDDA 101 >sp|O04977.1|FENR1_TOBAC RecName: Full=Ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic; Short=FNR; Flags: Precursor [Nicotiana tabacum] gi|2225993|emb|CAA74359.1| ferredoxin--NADP(+) reductase [Nicotiana tabacum] Length = 362 Score = 110 bits (274), Expect = 5e-22 Identities = 53/70 (75%), Positives = 61/70 (87%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV GG ++V IRAQVTTEAPAKVEK+SKK +EGV+VNKF+PK PY+GRCL Sbjct: 33 FNKVPLYYRNVSGGSRLV-SIRAQVTTEAPAKVEKISKKQDEGVIVNKFRPKEPYVGRCL 91 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 92 LNTKITGDDA 101 >ref|XP_011099850.1| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic [Sesamum indicum] Length = 366 Score = 109 bits (273), Expect = 6e-22 Identities = 55/70 (78%), Positives = 58/70 (82%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY+RNV G VVPIRAQV TEAPAKVEK KK EEGVVVN FKPK+PYIGRCL Sbjct: 36 FNKVPLYNRNVSLAGNKVVPIRAQVATEAPAKVEKEHKKQEEGVVVNVFKPKDPYIGRCL 95 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 96 LNTKITGDDA 105 >ref|XP_009794242.1| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic [Nicotiana sylvestris] Length = 362 Score = 109 bits (272), Expect = 8e-22 Identities = 55/70 (78%), Positives = 60/70 (85%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV G + VV IRAQVTTEAPAKVEK+SKK +EGVVVNKF+PK PYIGRCL Sbjct: 33 FNKVPLYYRNVSAGSR-VVSIRAQVTTEAPAKVEKISKKQDEGVVVNKFRPKEPYIGRCL 91 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 92 LNTKITGDDA 101 >ref|XP_009413066.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 369 Score = 109 bits (272), Expect = 8e-22 Identities = 53/72 (73%), Positives = 59/72 (81%), Gaps = 2/72 (2%) Frame = -2 Query: 212 FHKTCLYSRNV--CGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGR 39 FHK CLYSR+V K +V +RAQVTTEAPAKV KVSKKN+EGVV NK+KPK PY+G Sbjct: 37 FHKACLYSRSVSTANARKKLVAVRAQVTTEAPAKVAKVSKKNDEGVVTNKYKPKEPYVGT 96 Query: 38 CLLNTKITGDDA 3 CLLNTKITGDDA Sbjct: 97 CLLNTKITGDDA 108 >ref|XP_009588213.1| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic [Nicotiana tomentosiformis] Length = 362 Score = 108 bits (271), Expect = 1e-21 Identities = 54/70 (77%), Positives = 60/70 (85%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV G + VV IRAQVTTEAPAKVEK+SKK +EGVVVNKF+PK PY+GRCL Sbjct: 33 FNKVPLYYRNVSAGSR-VVSIRAQVTTEAPAKVEKISKKQDEGVVVNKFRPKEPYVGRCL 91 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 92 LNTKITGDDA 101 >gb|AAZ85322.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808646|gb|AAZ85323.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808648|gb|AAZ85324.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808650|gb|AAZ85325.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808652|gb|AAZ85326.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808654|gb|AAZ85327.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808656|gb|AAZ85328.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808658|gb|AAZ85329.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808660|gb|AAZ85330.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] gi|73808662|gb|AAZ85331.1| putative ferredoxin NADP reductase, partial [Solanum pimpinellifolium] Length = 314 Score = 108 bits (271), Expect = 1e-21 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = -2 Query: 212 FHKTCLYSRNVCGGGKMVVPIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYIGRCL 33 F+K LY RNV G ++V IRAQVTTEAPAKVEK+SKK EEGV+VNKF+PK PY+GRCL Sbjct: 4 FNKVPLYYRNVSGASRLV-SIRAQVTTEAPAKVEKISKKQEEGVIVNKFRPKEPYVGRCL 62 Query: 32 LNTKITGDDA 3 LNTKITGDDA Sbjct: 63 LNTKITGDDA 72