BLASTX nr result
ID: Anemarrhena21_contig00049003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00049003 (548 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_040401634.1| hypothetical protein, partial [Cecembia lona... 62 1e-07 emb|CCH50976.1| T4.15 [Malus x robusta] 62 1e-07 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 62 2e-07 emb|CCH50954.1| T1.2 [Malus x robusta] 60 6e-07 ref|XP_008354068.1| PREDICTED: uncharacterized protein LOC103417... 59 2e-06 gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptas... 56 8e-06 >ref|WP_040401634.1| hypothetical protein, partial [Cecembia lonarensis] Length = 232 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 393 NLFNKITSTREMANE*EIKTLVTIYKNKGDRKNCLNFRGIKLMSY 259 +LFN+I T++M NE TLV IYKNKGD +NC+N+RGIKLMS+ Sbjct: 153 DLFNRILKTKKMPNEWRTSTLVPIYKNKGDVQNCMNYRGIKLMSH 197 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 393 NLFNKITSTREMANE*EIKTLVTIYKNKGDRKNCLNFRGIKLMSY 259 +LFN+I T++M NE TLV IYKNKGD +NC+N+RGIKLMS+ Sbjct: 601 DLFNRILKTKKMPNEWRTSTLVPIYKNKGDVQNCMNYRGIKLMSH 645 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 396 INLFNKITSTREMANE*EIKTLVTIYKNKGDRKNCLNFRGIKLMSY 259 I+LFN+I T++M NE LV IYKNKGD +NC+N+RGIKLMS+ Sbjct: 204 IDLFNRILKTKKMPNEWRTSPLVPIYKNKGDVQNCMNYRGIKLMSH 249 >emb|CCH50954.1| T1.2 [Malus x robusta] Length = 554 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -3 Query: 393 NLFNKITSTREMANE*EIKTLVTIYKNKGDRKNCLNFRGIKLMSY 259 +LFN+I ++M+NE TLV IYKNKGD +NC+N+RGIKLMS+ Sbjct: 224 DLFNRILKMKKMSNEWRNSTLVPIYKNKGDIQNCMNYRGIKLMSH 268 >ref|XP_008354068.1| PREDICTED: uncharacterized protein LOC103417687 [Malus domestica] Length = 907 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -3 Query: 393 NLFNKITSTREMANE*EIKTLVTIYKNKGDRKNCLNFRGIKLMSY 259 +LFN+I T++M NE TLV IYKNKGD +NC+N+R IKL S+ Sbjct: 502 BLFNRILKTKKMPNEWRXSTLVPIYKNKGDVQNCMNYRXIKLXSH 546 >gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 517 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -3 Query: 393 NLFNKITSTREMANE*EIKTLVTIYKNKGDRKNCLNFRGIKLMSY 259 NLFN+I T++M++E TL+ I KNKGD +NC N+RGIKLMS+ Sbjct: 183 NLFNEIIRTKKMSDEWRRSTLIPIDKNKGDIQNCANYRGIKLMSH 227