BLASTX nr result
ID: Anemarrhena21_contig00048885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048885 (356 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63139.1| Reverse transcriptase family protein [Asparagus o... 45 1e-08 >gb|ABD63139.1| Reverse transcriptase family protein [Asparagus officinalis] Length = 1181 Score = 45.1 bits (105), Expect(2) = 1e-08 Identities = 28/83 (33%), Positives = 44/83 (53%) Frame = +2 Query: 2 EGEEEALTVQSSASQPTGTRSGRAYLKQYGQTSGKNQQQSTSNALIESRDPQTSQPVKSS 181 + EEE + + + GTRSG+AYLK YGQ + + ++Q +D S P K Sbjct: 18 DSEEERIALAAYPGDNPGTRSGKAYLKDYGQNAQEVEEQ--------PQDAGGSVP-KKP 68 Query: 182 QQKDKGKEIRFDQALKKSDPQTS 250 K K KE+RF++ L + ++S Sbjct: 69 ADKGKQKELRFNRNLHQEHGESS 91 Score = 40.8 bits (94), Expect(2) = 1e-08 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +1 Query: 265 FDVMEQLKTIPTRITLHKLLMLSKETREAL 354 F+VM QL IP RITL++LL LSK T+EAL Sbjct: 96 FNVMAQLANIPARITLYELLRLSKTTKEAL 125