BLASTX nr result
ID: Anemarrhena21_contig00048802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048802 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EZF27069.1| 60S ribosomal protein L10a [Trichophyton rubrum M... 119 8e-25 ref|XP_008078498.1| Ribosomal protein L1 [Glarea lozoyensis ATCC... 118 2e-24 gb|ESZ95282.1| 60S ribosomal protein L10a [Sclerotinia borealis ... 117 2e-24 ref|XP_001598446.1| 60S ribosomal protein L1 [Sclerotinia sclero... 117 2e-24 ref|XP_001559318.1| 60S ribosomal protein L1 [Botrytis cinerea B... 117 2e-24 gb|KIN06250.1| hypothetical protein OIDMADRAFT_49742 [Oidiodendr... 117 3e-24 gb|EPQ65960.1| N-terminally acetylated protein component of the ... 117 3e-24 ref|XP_007295005.1| 60S ribosomal protein L1 [Marssonina brunnea... 117 4e-24 gb|KHJ31088.1| putative 60s ribosomal protein l1 [Erysiphe necator] 116 7e-24 gb|KLU87388.1| 60S ribosomal protein L10a [Magnaporthiopsis poae... 113 4e-23 ref|XP_007580500.1| putative 60s ribosomal protein l10a protein ... 113 4e-23 dbj|GAA89411.1| flavin-binding monooxygenase [Aspergillus kawach... 113 4e-23 gb|KJJ10427.1| Ribosomal protein L1 [Penicillium solitum] 113 6e-23 gb|KIV79414.1| 60S ribosomal protein L10a [Exophiala sideris] 113 6e-23 gb|KGO46554.1| Ribosomal protein L1, superfamily [Penicillium ex... 113 6e-23 ref|XP_009217992.1| 60S ribosomal protein L10a [Gaeumannomyces g... 113 6e-23 gb|KFX88154.1| hypothetical protein V490_07801 [Pseudogymnoascus... 112 7e-23 gb|EKG19417.1| hypothetical protein MPH_03280 [Macrophomina phas... 112 7e-23 ref|XP_003304564.1| 60S ribosomal protein L1 [Pyrenophora teres ... 112 7e-23 ref|XP_001931082.1| 60S ribosomal protein L1 [Pyrenophora tritic... 112 7e-23 >gb|EZF27069.1| 60S ribosomal protein L10a [Trichophyton rubrum MR850] gi|607909195|gb|EZF46164.1| 60S ribosomal protein L10a [Trichophyton rubrum CBS 100081] gi|607921224|gb|EZF56780.1| 60S ribosomal protein L10a [Trichophyton rubrum CBS 288.86] gi|607933298|gb|EZF67421.1| 60S ribosomal protein L10a [Trichophyton rubrum CBS 289.86] gi|607945181|gb|EZF78021.1| 60S ribosomal protein L10a [Trichophyton soudanense CBS 452.61] gi|607957365|gb|EZF88745.1| 60S ribosomal protein L10a [Trichophyton rubrum MR1448] gi|607969518|gb|EZF99502.1| 60S ribosomal protein L10a [Trichophyton rubrum MR1459] gi|607981738|gb|EZG10628.1| 60S ribosomal protein L10a [Trichophyton rubrum CBS 735.88] gi|607993568|gb|EZG21080.1| 60S ribosomal protein L10a [Trichophyton rubrum CBS 202.88] gi|633063645|gb|KDB37866.1| 60S ribosomal protein L10a [Trichophyton rubrum D6] gi|674809849|gb|EGD91769.2| 60S ribosomal protein L10a [Trichophyton rubrum CBS 118892] Length = 270 Score = 119 bits (298), Expect = 8e-25 Identities = 60/70 (85%), Positives = 64/70 (91%), Gaps = 1/70 (1%) Frame = -1 Query: 207 QEFYWKTV-IMSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFS 31 Q F+WKTV IMSKITVAGVRTNVQQLL+YS KKRNF+ETVELQIGLKNYDPQRDKRFS Sbjct: 44 QVFFWKTVLIMSKITVAGVRTNVQQLLDYSHNEKKRNFVETVELQIGLKNYDPQRDKRFS 103 Query: 30 GTIRLPVVPR 1 GTI+LP VPR Sbjct: 104 GTIKLPTVPR 113 >ref|XP_008078498.1| Ribosomal protein L1 [Glarea lozoyensis ATCC 20868] gi|512205742|gb|EPE34563.1| Ribosomal protein L1 [Glarea lozoyensis ATCC 20868] Length = 217 Score = 118 bits (295), Expect = 2e-24 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQ LLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR Sbjct: 1 MSKITVAGVRTNVQSLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 60 >gb|ESZ95282.1| 60S ribosomal protein L10a [Sclerotinia borealis F-4157] Length = 217 Score = 117 bits (294), Expect = 2e-24 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQ LLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLP+VPR Sbjct: 1 MSKITVAGVRTNVQSLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPIVPR 60 >ref|XP_001598446.1| 60S ribosomal protein L1 [Sclerotinia sclerotiorum 1980 UF-70] gi|154691394|gb|EDN91132.1| 60S ribosomal protein L1 [Sclerotinia sclerotiorum 1980 UF-70] Length = 217 Score = 117 bits (294), Expect = 2e-24 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQ LLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGT+RLPVVPR Sbjct: 1 MSKITVAGVRTNVQSLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTVRLPVVPR 60 >ref|XP_001559318.1| 60S ribosomal protein L1 [Botrytis cinerea B05.10] gi|347828301|emb|CCD43998.1| similar to 60s ribosomal protein L10A [Botrytis cinerea T4] gi|472239136|gb|EMR83961.1| putative 60s ribosomal protein l10a protein [Botrytis cinerea BcDW1] Length = 217 Score = 117 bits (294), Expect = 2e-24 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQ LLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGT+RLPVVPR Sbjct: 1 MSKITVAGVRTNVQSLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTVRLPVVPR 60 >gb|KIN06250.1| hypothetical protein OIDMADRAFT_49742 [Oidiodendron maius Zn] Length = 217 Score = 117 bits (293), Expect = 3e-24 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQ+LL+YSLETKKRNFLETVELQIGLKNYDPQRDKRFSGT+RLPVVPR Sbjct: 1 MSKITVAGVRTNVQELLQYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTVRLPVVPR 60 >gb|EPQ65960.1| N-terminally acetylated protein component of the 60S ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528294493|emb|CCU79792.1| putative 60S ribosomal protein L10a [Blumeria graminis f. sp. hordei DH14] Length = 217 Score = 117 bits (293), Expect = 3e-24 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQQLLEYS ETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR Sbjct: 1 MSKITVAGVRTNVQQLLEYSHETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 60 >ref|XP_007295005.1| 60S ribosomal protein L1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861852|gb|EKD14905.1| 60S ribosomal protein L1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 218 Score = 117 bits (292), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -1 Query: 177 SKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 SKITVAGVRTNVQQLL+YSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR Sbjct: 3 SKITVAGVRTNVQQLLQYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 61 >gb|KHJ31088.1| putative 60s ribosomal protein l1 [Erysiphe necator] Length = 217 Score = 116 bits (290), Expect = 7e-24 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVR+NVQQLLEYS ETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPV+PR Sbjct: 1 MSKITVAGVRSNVQQLLEYSTETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVIPR 60 >gb|KLU87388.1| 60S ribosomal protein L10a [Magnaporthiopsis poae ATCC 64411] Length = 217 Score = 113 bits (283), Expect = 4e-23 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVR+NV +LLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTI+LPVVPR Sbjct: 1 MSKITVAGVRSNVGELLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPVVPR 60 >ref|XP_007580500.1| putative 60s ribosomal protein l10a protein [Neofusicoccum parvum UCRNP2] gi|485928305|gb|EOD52041.1| putative 60s ribosomal protein l10a protein [Neofusicoccum parvum UCRNP2] Length = 217 Score = 113 bits (283), Expect = 4e-23 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQQLLEYS ETKKRNFLETVELQIGLKNYDPQRDKRFSGT++LP VPR Sbjct: 1 MSKITVAGVRTNVQQLLEYSNETKKRNFLETVELQIGLKNYDPQRDKRFSGTVKLPKVPR 60 >dbj|GAA89411.1| flavin-binding monooxygenase [Aspergillus kawachii IFO 4308] Length = 853 Score = 113 bits (283), Expect = 4e-23 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 1/69 (1%) Frame = -1 Query: 204 EFYWKTV-IMSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSG 28 +F+WKTV MSKITVAGVR N++QLL YS KKRNFLETVELQIGLKNYDPQRDKRFSG Sbjct: 628 KFFWKTVSTMSKITVAGVRQNIEQLLNYSQNEKKRNFLETVELQIGLKNYDPQRDKRFSG 687 Query: 27 TIRLPVVPR 1 TI+LP VPR Sbjct: 688 TIKLPTVPR 696 >gb|KJJ10427.1| Ribosomal protein L1 [Penicillium solitum] Length = 267 Score = 113 bits (282), Expect = 6e-23 Identities = 57/68 (83%), Positives = 60/68 (88%), Gaps = 1/68 (1%) Frame = -1 Query: 201 FYWKTV-IMSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGT 25 F+WKTV IMSKITVAGVR NV+ LL YSL KKRNF ETVELQIGLKNYDPQRDKRFSGT Sbjct: 43 FFWKTVAIMSKITVAGVRQNVENLLNYSLNEKKRNFNETVELQIGLKNYDPQRDKRFSGT 102 Query: 24 IRLPVVPR 1 I+LP VPR Sbjct: 103 IKLPTVPR 110 >gb|KIV79414.1| 60S ribosomal protein L10a [Exophiala sideris] Length = 217 Score = 113 bits (282), Expect = 6e-23 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVRTNVQQLLEYSL KKRNFLETVELQIGLKNYDPQRDKRFSGTI+LP VPR Sbjct: 1 MSKITVAGVRTNVQQLLEYSLNEKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPTVPR 60 >gb|KGO46554.1| Ribosomal protein L1, superfamily [Penicillium expansum] gi|700464745|gb|KGO53609.1| Ribosomal protein L1, superfamily [Penicillium expansum] gi|700478516|gb|KGO65855.1| Ribosomal protein L1, superfamily [Penicillium expansum] Length = 265 Score = 113 bits (282), Expect = 6e-23 Identities = 57/68 (83%), Positives = 60/68 (88%), Gaps = 1/68 (1%) Frame = -1 Query: 201 FYWKTV-IMSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGT 25 F+WKTV IMSKITVAGVR NV+ LL YSL KKRNF ETVELQIGLKNYDPQRDKRFSGT Sbjct: 41 FFWKTVAIMSKITVAGVRQNVENLLNYSLNEKKRNFNETVELQIGLKNYDPQRDKRFSGT 100 Query: 24 IRLPVVPR 1 I+LP VPR Sbjct: 101 IKLPTVPR 108 >ref|XP_009217992.1| 60S ribosomal protein L10a [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402087085|gb|EJT81983.1| 60S ribosomal protein L10a [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 217 Score = 113 bits (282), Expect = 6e-23 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKITVAGVR+NV +LLEYSLETKKRNFLET+ELQIGLKNYDPQRDKRFSGTI+LPVVPR Sbjct: 1 MSKITVAGVRSNVGELLEYSLETKKRNFLETIELQIGLKNYDPQRDKRFSGTIKLPVVPR 60 >gb|KFX88154.1| hypothetical protein V490_07801 [Pseudogymnoascus pannorum VKM F-3557] gi|682271537|gb|KFX95346.1| hypothetical protein O988_05836 [Pseudogymnoascus pannorum VKM F-3808] gi|682335940|gb|KFY32727.1| hypothetical protein V495_08787 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682368365|gb|KFY54136.1| hypothetical protein V497_07940 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 218 Score = 112 bits (281), Expect = 7e-23 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -1 Query: 177 SKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 SKITVAGVRT+VQ+LLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLP VPR Sbjct: 3 SKITVAGVRTHVQELLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPQVPR 61 >gb|EKG19417.1| hypothetical protein MPH_03280 [Macrophomina phaseolina MS6] Length = 498 Score = 112 bits (281), Expect = 7e-23 Identities = 55/64 (85%), Positives = 61/64 (95%) Frame = -1 Query: 192 KTVIMSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLP 13 ++ IMSKITVAGVRTNV++LLEYS ETKKRNFLETVELQIGLKNYDPQRDKRFSGT++LP Sbjct: 278 RSFIMSKITVAGVRTNVKELLEYSNETKKRNFLETVELQIGLKNYDPQRDKRFSGTVKLP 337 Query: 12 VVPR 1 VPR Sbjct: 338 RVPR 341 >ref|XP_003304564.1| 60S ribosomal protein L1 [Pyrenophora teres f. teres 0-1] gi|311318743|gb|EFQ87338.1| hypothetical protein PTT_17202 [Pyrenophora teres f. teres 0-1] Length = 217 Score = 112 bits (281), Expect = 7e-23 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKI+VAGVRTNVQQLLEYS ETKKRNFLETVELQIGLKNYDPQRDKRFSGTI+LP +PR Sbjct: 1 MSKISVAGVRTNVQQLLEYSNETKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPTIPR 60 >ref|XP_001931082.1| 60S ribosomal protein L1 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972688|gb|EDU40187.1| 60S ribosomal protein L10a [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 217 Score = 112 bits (281), Expect = 7e-23 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 180 MSKITVAGVRTNVQQLLEYSLETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPVVPR 1 MSKI+VAGVRTNVQQLLEYS ETKKRNFLETVELQIGLKNYDPQRDKRFSGTI+LP +PR Sbjct: 1 MSKISVAGVRTNVQQLLEYSNETKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPTIPR 60