BLASTX nr result
ID: Anemarrhena21_contig00048671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048671 (369 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010111543.1| hypothetical protein L484_004942 [Morus nota... 60 4e-07 ref|XP_002280276.2| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_010254771.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 >ref|XP_010111543.1| hypothetical protein L484_004942 [Morus notabilis] gi|587944723|gb|EXC31176.1| hypothetical protein L484_004942 [Morus notabilis] Length = 660 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Frame = -1 Query: 195 LITRHLPSLSP-LLFNILIQSYSKSSDSHCSIHLFLHILSLKEKPKLLHIPDKYTFTFVI 19 L R+ SL P L++N++I++YSK +S S+HLF +L++ E K +PDKYTFTFVI Sbjct: 101 LFDRYPSSLPPTLVWNLMIRAYSKLQNSQESLHLFTQMLAMNEGLKA--VPDKYTFTFVI 158 Query: 18 SSCSRE 1 +SCS + Sbjct: 159 TSCSHQ 164 >ref|XP_002280276.2| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Vitis vinifera] Length = 684 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/70 (45%), Positives = 50/70 (71%), Gaps = 2/70 (2%) Frame = -1 Query: 204 HAQLITRHLPSLSP--LLFNILIQSYSKSSDSHCSIHLFLHILSLKEKPKLLHIPDKYTF 31 +A+++ H PS SP L+N++I++YSK +S IHLFL +L+L ++ +PD+YTF Sbjct: 124 NARILFDHYPSPSPPIKLWNVMIRTYSKIRNSQEPIHLFLRMLTLDGPMQV--VPDEYTF 181 Query: 30 TFVISSCSRE 1 TFVI+SCS + Sbjct: 182 TFVITSCSHQ 191 >ref|XP_010254771.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Nelumbo nucifera] Length = 660 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/64 (46%), Positives = 45/64 (70%) Frame = -1 Query: 195 LITRHLPSLSPLLFNILIQSYSKSSDSHCSIHLFLHILSLKEKPKLLHIPDKYTFTFVIS 16 L ++ SL L++N++IQ+YSK+ +S S++LF +L+L L PDKYTFTFVI+ Sbjct: 102 LFDQYPSSLPTLVWNLMIQAYSKTPNSRESLYLFCRMLALDPSLALAVKPDKYTFTFVIT 161 Query: 15 SCSR 4 +CSR Sbjct: 162 ACSR 165