BLASTX nr result
ID: Anemarrhena21_contig00048560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048560 (264 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612306.1| HAT family dimerization domain containing pr... 67 6e-09 ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago ... 64 4e-08 ref|XP_002528871.1| conserved hypothetical protein [Ricinus comm... 60 6e-07 ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medica... 59 1e-06 ref|XP_003608397.1| Tubulin beta chain [Medicago truncatula] gi|... 58 3e-06 ref|XP_003612304.1| F-box protein [Medicago truncatula] 57 6e-06 >ref|XP_003612306.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 257 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 9 VIKDERVQEKKYLCAWGNDAASEVITEARQLLVENYFQTPSSARV 143 ++K ++ + +LCAWGNDAA+EV+TEAR LLVENYFQTPS RV Sbjct: 212 ILKHVKLNSRNHLCAWGNDAANEVLTEARLLLVENYFQTPSRLRV 256 >ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago truncatula] Length = 220 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 39 KYLCAWGNDAASEVITEARQLLVENYFQTPSSARVQLG 152 K+LCAWGND A+EVITEAR LLVENYFQTPS + LG Sbjct: 182 KHLCAWGNDVANEVITEARLLLVENYFQTPSGPELALG 219 >ref|XP_002528871.1| conserved hypothetical protein [Ricinus communis] gi|223531670|gb|EEF33495.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -1 Query: 225 KRFIIMYCRALPWVRGSPSRNSRRTRAEPGPKRGFGNSFQPAIDAPRL*PH 73 K ++ CR LP + P + + + +PGPKRGFGNSFQPAIDAPRL PH Sbjct: 46 KSLLLENCRTLP--QREPFQKFSKAKGKPGPKRGFGNSFQPAIDAPRLEPH 94 >ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355496649|gb|AES77852.1| serine carboxypeptidase-like protein [Medicago truncatula] Length = 105 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 42 YLCAWGNDAASEVITEARQLLVENYFQTPS 131 +LCAWGNDAA+EV+TEAR LLVENYFQTPS Sbjct: 76 HLCAWGNDAANEVLTEARLLLVENYFQTPS 105 >ref|XP_003608397.1| Tubulin beta chain [Medicago truncatula] gi|355509452|gb|AES90594.1| beta-tubulin, putative [Medicago truncatula] Length = 65 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 18 DERVQEKKYLCAWGNDAASEVITEARQLLVENYFQTPS 131 +E ++LCAWGNDAA+EV TE R LLVENYFQTPS Sbjct: 28 EESTPRLRHLCAWGNDAANEVPTEVRLLLVENYFQTPS 65 >ref|XP_003612304.1| F-box protein [Medicago truncatula] Length = 254 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 36 KKYLCAWGNDAASEVITEARQLLVENYFQTPS 131 + +LCAWGNDAA+EV+TEAR LLVENYFQT S Sbjct: 223 RNHLCAWGNDAANEVLTEARLLLVENYFQTHS 254