BLASTX nr result
ID: Anemarrhena21_contig00048250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048250 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_028986336.1| ribonuclease H [Thermicanus aegyptius] 72 2e-10 ref|WP_005588650.1| ribonuclease H [Clostridium ultunense] gi|45... 69 1e-09 ref|WP_013992952.1| ribonuclease H [Zobellia galactanivorans] gi... 65 2e-08 ref|WP_027065679.1| ribonuclease H [Maribacter sp. Hel_I_7] 65 2e-08 ref|WP_036643669.1| ribonuclease H [Parabacteroides distasonis] ... 65 2e-08 ref|WP_036633459.1| ribonuclease H [Parabacteroides distasonis] ... 65 2e-08 ref|WP_019007846.1| hypothetical protein [Cohnella laeviribosi] 64 4e-08 ref|WP_036784415.1| ribonuclease H [Polaribacter sp. Hel1_33_49]... 62 1e-07 ref|WP_024740038.1| ribonuclease H [Tenacibaculum maritimum] 62 1e-07 ref|WP_046821738.1| hypothetical protein [Clostridium sp. JC272]... 62 1e-07 ref|WP_025162877.1| hypothetical protein [[Clostridium] bifermen... 62 1e-07 ref|WP_021429362.1| RNase H family protein [[Clostridium] biferm... 62 1e-07 ref|WP_044638054.1| ribonuclease H [Siansivirga zeaxanthinifacie... 62 2e-07 ref|WP_022452793.1| hypothetical protein [Prevotella sp. CAG:873... 62 2e-07 ref|XP_011494583.1| PREDICTED: ribonuclease H1 [Ceratosolen solm... 61 2e-07 ref|WP_026452130.1| ribonuclease H [Aequorivita capsosiphonis] 61 2e-07 ref|WP_036618933.1| ribonuclease H [Parabacteroides distasonis] ... 61 2e-07 ref|WP_005864047.1| MULTISPECIES: ribonuclease H [Bacteroidales]... 61 2e-07 ref|WP_022192297.1| ribonuclease H [Parabacteroides sp. CAG:2] g... 61 2e-07 ref|WP_008778800.1| ribonuclease H [Parabacteroides sp. 20_3] gi... 61 2e-07 >ref|WP_028986336.1| ribonuclease H [Thermicanus aegyptius] Length = 218 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/64 (51%), Positives = 44/64 (68%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV++GR PGIY W ECK+Q+H FPG +KSF EEAER++++ D EG + Sbjct: 3 KPKYYVVWKGRRPGIYTRWEECKEQIHHFPGARYKSFSTKEEAERAYKE---DIEGSFFT 59 Query: 60 KPKT 49 K K+ Sbjct: 60 KGKS 63 >ref|WP_005588650.1| ribonuclease H [Clostridium ultunense] gi|452990499|emb|CCQ98285.1| Ribonuclease H [Clostridium ultunense Esp] Length = 218 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSF-EKFQGDF 79 K K YVV++GR PGIY W ECK+Q+H FPG +KSF EEAER++ E +G F Sbjct: 3 KPKYYVVWKGRRPGIYTRWEECKEQIHHFPGARYKSFSTKEEAERAYKEAIEGSF 57 >ref|WP_013992952.1| ribonuclease H [Zobellia galactanivorans] gi|339732375|emb|CAZ95643.1| Ribonuclease H [Zobellia galactanivorans] Length = 211 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/63 (44%), Positives = 41/63 (65%) Frame = -2 Query: 243 EKGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSM 64 +K K Y V++G+ PGIYDSW +CK + F G +KSF+ E+A+++F DF+GK Sbjct: 3 KKAKFYTVWQGKKPGIYDSWSDCKAAITGFKGAQYKSFETFEQAKKAFNGNYNDFKGKKK 62 Query: 63 SKP 55 KP Sbjct: 63 GKP 65 >ref|WP_027065679.1| ribonuclease H [Maribacter sp. Hel_I_7] Length = 211 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 5/79 (6%) Frame = -2 Query: 243 EKGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGK-- 70 +KGK YVV++G+ PGI+DSW ECK+ + + G +KSF+ E A++++ DF+GK Sbjct: 3 KKGKFYVVWKGKKPGIFDSWKECKKSIANYAGAEYKSFESFETAKKAYNSNYADFKGKKK 62 Query: 69 ---SMSKPKTVVKNERFYH 22 S+SK + + + YH Sbjct: 63 TASSLSKEELLRIGQPNYH 81 >ref|WP_036643669.1| ribonuclease H [Parabacteroides distasonis] gi|649564878|gb|KDS71027.1| ribonuclease H [Parabacteroides distasonis str. 3999B T(B) 4] Length = 211 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/67 (49%), Positives = 43/67 (64%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV++G NPGIYD+W ECK QV G +KSF+ PEEA ++FE + K+ S Sbjct: 3 KNKFYVVWKGLNPGIYDNWAECKAQVDGQEGAKYKSFENPEEAAKAFEAGYTHYL-KTAS 61 Query: 60 KPKTVVK 40 PK V + Sbjct: 62 SPKAVAR 68 >ref|WP_036633459.1| ribonuclease H [Parabacteroides distasonis] gi|649556371|gb|KDS62879.1| ribonuclease H [Parabacteroides distasonis str. 3999B T(B) 6] Length = 211 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/67 (49%), Positives = 43/67 (64%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV++G NPGIYD+W ECK QV G +KSF+ PEEA ++FE + K+ S Sbjct: 3 KNKFYVVWKGLNPGIYDNWAECKAQVDGQEGAKYKSFENPEEAAKAFEAGYTHYL-KTAS 61 Query: 60 KPKTVVK 40 PK V + Sbjct: 62 SPKAVAR 68 >ref|WP_019007846.1| hypothetical protein [Cohnella laeviribosi] Length = 212 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSF 100 K K YVV+ GRNPGIY+SWPEC++Q+ +F G +KSF+ EAE +F Sbjct: 3 KPKYYVVWAGRNPGIYESWPECRKQIEKFEGAKYKSFESRAEAEAAF 49 >ref|WP_036784415.1| ribonuclease H [Polaribacter sp. Hel1_33_49] gi|697006867|gb|KGL60052.1| ribonuclease HI-related protein 3 [Polaribacter sp. Hel1_33_49] Length = 211 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/62 (46%), Positives = 39/62 (62%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV+ GR GI+ SW CK+Q+ F G +KSF +EAE +F K D++GK+ Sbjct: 3 KKKFYVVWNGRKKGIFSSWGVCKKQIDGFEGALYKSFANLDEAETAFAKNYEDYKGKNTK 62 Query: 60 KP 55 KP Sbjct: 63 KP 64 >ref|WP_024740038.1| ribonuclease H [Tenacibaculum maritimum] Length = 212 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/73 (39%), Positives = 41/73 (56%) Frame = -2 Query: 243 EKGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSM 64 +K K YVV++G GIY SW CK+Q+ + G +KSF +EAE +F K D+ GK+ Sbjct: 3 KKKKYYVVWQGHKKGIYTSWSNCKKQIDGYQGAQYKSFTDKKEAELAFTKTYNDYRGKNT 62 Query: 63 SKPKTVVKNERFY 25 P K + Y Sbjct: 63 KNPTLSAKEKAQY 75 >ref|WP_046821738.1| hypothetical protein [Clostridium sp. JC272] gi|821021054|gb|KKY02723.1| hypothetical protein VN21_01670 [Clostridium sp. JC272] Length = 239 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 234 KKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMSKP 55 K Y V G+ PG+Y +W ECK+QV++FPG+ +KSFK EEA EKF G K Sbjct: 4 KFYAVKVGKKPGVYTTWDECKEQVNKFPGSIYKSFKTLEEA----EKFAGIKVENISKKS 59 Query: 54 KTVVKNE 34 KT VK++ Sbjct: 60 KTNVKSK 66 >ref|WP_025162877.1| hypothetical protein [[Clostridium] bifermentans] Length = 239 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 234 KKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMSKP 55 K Y V G+ PG+Y +W ECK+QV++FPG+ +KSFK EEA EKF G K Sbjct: 4 KFYAVKVGKKPGVYTTWDECKEQVNKFPGSIYKSFKTLEEA----EKFAGIKVENISKKS 59 Query: 54 KTVVKNE 34 KT VK++ Sbjct: 60 KTNVKSK 66 >ref|WP_021429362.1| RNase H family protein [[Clostridium] bifermentans] gi|531770547|gb|EQK46749.1| RNase H family protein [ [[Clostridium] bifermentans ATCC 19299] Length = 239 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 234 KKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMSKP 55 K Y V G+ PG+Y +W ECK+QV++FPG+ +KSFK EEA EKF G K Sbjct: 4 KFYAVKVGKKPGVYTTWDECKEQVNKFPGSIYKSFKTLEEA----EKFAGIKVENISKKS 59 Query: 54 KTVVKNE 34 KT VK++ Sbjct: 60 KTNVKSK 66 >ref|WP_044638054.1| ribonuclease H [Siansivirga zeaxanthinifaciens] gi|764063346|gb|AJR03362.1| ribonuclease H [Siansivirga zeaxanthinifaciens CC-SAMT-1] Length = 210 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV+EGR GI +SW EC + H + G +KSFK E AE+++ + D++G Sbjct: 3 KPKYYVVWEGRKKGILESWAECTESTHGYKGAKYKSFKTRELAEKAYSESYEDYKG---- 58 Query: 60 KPKTVVKNERFYHE*KKVG 4 KT+ + E E KK+G Sbjct: 59 --KTIFETELSDDELKKIG 75 >ref|WP_022452793.1| hypothetical protein [Prevotella sp. CAG:873] gi|524756636|emb|CDE58312.1| putative uncharacterized protein [Prevotella sp. CAG:873] Length = 215 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 3/75 (4%) Frame = -2 Query: 234 KKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFE---GKSM 64 K YVV+EGR PGIYDSW ECK+Q+ FPG +++F+ +EA + ++ + K+M Sbjct: 5 KFYVVFEGRAPGIYDSWEECKEQIDGFPGANYRAFQDQDEATEALRRYDSGEDMAIYKAM 64 Query: 63 SKPKTVVKNERFYHE 19 + T V N + E Sbjct: 65 RRRNTAVVNYAAFPE 79 >ref|XP_011494583.1| PREDICTED: ribonuclease H1 [Ceratosolen solmsi marchali] gi|766925383|ref|XP_011494584.1| PREDICTED: ribonuclease H1 [Ceratosolen solmsi marchali] Length = 282 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = -2 Query: 228 YVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSM-SKPK 52 Y V +GRNPGIY +W ECK QVH+FPG K F EAE + F G S+ +K K Sbjct: 27 YAVAKGRNPGIYGTWNECKTQVHKFPGPLFKKFNSKIEAENFIKNHSNSFAGTSLKAKRK 86 Query: 51 TV 46 ++ Sbjct: 87 SI 88 >ref|WP_026452130.1| ribonuclease H [Aequorivita capsosiphonis] Length = 210 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/62 (41%), Positives = 42/62 (67%) Frame = -2 Query: 243 EKGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSM 64 +K K YVV+ G GI+ SW ECK+ +H PG +KSF+ +EA++++ K D++GK++ Sbjct: 3 KKQKFYVVWFGNPAGIFKSWKECKRSIHGVPGAQYKSFETLDEAKKAYNKSYADYKGKTV 62 Query: 63 SK 58 K Sbjct: 63 KK 64 >ref|WP_036618933.1| ribonuclease H [Parabacteroides distasonis] gi|649534202|gb|KDS41416.1| ribonuclease H [Parabacteroides distasonis str. 3776 Po2 i] gi|649565408|gb|KDS71551.1| ribonuclease H [Parabacteroides distasonis str. 3776 D15 iv] Length = 211 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV++G NPGIYD+W ECK QV G +KSF+ EEA ++FE + K+ S Sbjct: 3 KNKFYVVWKGLNPGIYDNWAECKAQVDGQEGAKYKSFENREEAAKAFEAGYTHYL-KTAS 61 Query: 60 KPKTVVK 40 PK V + Sbjct: 62 SPKAVAR 68 >ref|WP_005864047.1| MULTISPECIES: ribonuclease H [Bacteroidales] gi|262293661|gb|EEY81596.1| ribonuclease H [Bacteroides sp. 2_1_33B] gi|409236861|gb|EKN29665.1| hypothetical protein HMPREF1059_01266 [Parabacteroides distasonis CL09T03C24] gi|649526965|gb|KDS34505.1| ribonuclease H [Parabacteroides distasonis str. 3776 D15 i] Length = 211 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV++G NPGIYD+W ECK QV G +KSF+ EEA ++FE + K+ S Sbjct: 3 KNKFYVVWKGLNPGIYDNWAECKAQVDGQEGAKYKSFENREEAAKAFEAGYTHYL-KTAS 61 Query: 60 KPKTVVK 40 PK V + Sbjct: 62 SPKAVAR 68 >ref|WP_022192297.1| ribonuclease H [Parabacteroides sp. CAG:2] gi|524397919|emb|CDB50163.1| ribonuclease H [Parabacteroides sp. CAG:2] Length = 211 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV++G NPGIYD+W ECK QV G +KSF+ EEA ++FE + K+ S Sbjct: 3 KNKFYVVWKGLNPGIYDNWAECKAQVDGQEGAKYKSFENREEAAKAFEAGYTHYL-KTAS 61 Query: 60 KPKTVVK 40 PK V + Sbjct: 62 SPKAVAR 68 >ref|WP_008778800.1| ribonuclease H [Parabacteroides sp. 20_3] gi|300829738|gb|EFK60391.1| ribonuclease H [Parabacteroides sp. 20_3] Length = 211 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 240 KGKKYVVYEGRNPGIYDSWPECKQQVHRFPGNCHKSFKRPEEAERSFEKFQGDFEGKSMS 61 K K YVV++G NPGIYD+W ECK QV G +KSF+ EEA ++FE + K+ S Sbjct: 3 KNKFYVVWKGLNPGIYDNWAECKAQVDGQEGAKYKSFENREEAAKAFEAGYTHYL-KTAS 61 Query: 60 KPKTVVK 40 PK V + Sbjct: 62 SPKAVAR 68