BLASTX nr result
ID: Anemarrhena21_contig00048165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048165 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628657.1| hypothetical protein MTR_8g063140 [Medicago ... 58 2e-06 ref|XP_002320879.2| hypothetical protein POPTR_0014s09690g [Popu... 56 8e-06 >ref|XP_003628657.1| hypothetical protein MTR_8g063140 [Medicago truncatula] gi|355522679|gb|AET03133.1| hypothetical protein MTR_8g063140 [Medicago truncatula] Length = 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 112 MVSWCSWLSRQSNTLKVSGSSPGDAIFYILYF 207 MVSWCSWLSRQSNTLKVSGS+PG+AIF F Sbjct: 1 MVSWCSWLSRQSNTLKVSGSNPGEAIFMKFVF 32 >ref|XP_002320879.2| hypothetical protein POPTR_0014s09690g [Populus trichocarpa] gi|550323852|gb|EEE99194.2| hypothetical protein POPTR_0014s09690g [Populus trichocarpa] Length = 1098 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 115 VSWCSWLSRQSNTLKVSGSSPGDAI 189 VSWCSWLSRQSNTLKVSGSSPGDAI Sbjct: 8 VSWCSWLSRQSNTLKVSGSSPGDAI 32