BLASTX nr result
ID: Anemarrhena21_contig00048161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048161 (276 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010912874.1| PREDICTED: putative pentatricopeptide repeat... 57 6e-06 >ref|XP_010912874.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Elaeis guineensis] Length = 854 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -2 Query: 275 VERTRHVFVAGDLCHPERPLIYEMLASLNRQIKVPLSQR 159 VER RH FVAGDL HP RP+IY L +L+RQIK PLS R Sbjct: 815 VERMRHAFVAGDLSHPLRPIIYSTLRTLDRQIKDPLSPR 853