BLASTX nr result
ID: Anemarrhena21_contig00047965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00047965 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010931946.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 >ref|XP_010931946.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Elaeis guineensis] Length = 826 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/52 (61%), Positives = 35/52 (67%) Frame = -3 Query: 156 PRTKLQTQLEHLLQSCISSQSLHFHISPIHAHSLASGLSSDLFFTNLLLKAY 1 P K L HLLQSCIS Q+ H H+ PIHA S+ SGL SDLFF NLLL Y Sbjct: 19 PHVKRPQTLVHLLQSCISGQTHHLHLQPIHAQSIISGLRSDLFFNNLLLNGY 70