BLASTX nr result
ID: Anemarrhena21_contig00047620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00047620 (235 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Go... 94 3e-17 ref|XP_003588402.1| hypothetical protein MTR_1g006860 [Medicago ... 60 4e-07 >gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/52 (88%), Positives = 46/52 (88%) Frame = -1 Query: 196 KRFFLSRNLARPFHFRAGGNGIRTHDTIFLYVDLANQCLKPLSHTSKLLIGI 41 KRFFLSRN A P FRAGGNGIRTHDTIFLYVDLANQCLKPLSH SKLLI I Sbjct: 193 KRFFLSRNFACPLDFRAGGNGIRTHDTIFLYVDLANQCLKPLSHPSKLLIEI 244 >ref|XP_003588402.1| hypothetical protein MTR_1g006860 [Medicago truncatula] Length = 57 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +3 Query: 87 WFA-KSTYKKIVSWVRIPFPPARKWNGRAKLRERKNLFLM 203 WF+ + +V WVRIPFPPARKWNGRAKLRERKNL ++ Sbjct: 7 WFSGRQLELVVVVWVRIPFPPARKWNGRAKLRERKNLLVL 46