BLASTX nr result
ID: Anemarrhena21_contig00047581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00047581 (299 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012091495.1| PREDICTED: F-box protein At5g03100-like [Jat... 62 2e-07 ref|XP_004959744.1| PREDICTED: putative FBD-associated F-box pro... 57 4e-06 >ref|XP_012091495.1| PREDICTED: F-box protein At5g03100-like [Jatropha curcas] gi|643703823|gb|KDP20887.1| hypothetical protein JCGZ_21358 [Jatropha curcas] Length = 505 Score = 62.0 bits (149), Expect = 2e-07 Identities = 37/98 (37%), Positives = 53/98 (54%), Gaps = 5/98 (5%) Frame = -2 Query: 295 LLHHILSFFPSTKLHAQTSVLAKRWRHLWTHHPNLHISMPYPGNDNTDDYTDIAANYVLS 116 L HHILSF PST+ +TSVL+KRW+++WTH PNL + + Y + + Sbjct: 50 LTHHILSFLPSTEDVIKTSVLSKRWQYIWTHVPNLTFEL-------GESYKSV-RQFASF 101 Query: 115 VDRCLRSFNSPSLHSFSIVF-----WLPTPRSRAESKV 17 VD+ L + SP + +F+I WL + R ES V Sbjct: 102 VDKALIQYASPKIKNFAIDIDHNGRWLSKLQPRIESWV 139 >ref|XP_004959744.1| PREDICTED: putative FBD-associated F-box protein At5g56690 [Setaria italica] Length = 280 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/90 (36%), Positives = 51/90 (56%) Frame = -2 Query: 298 DLLHHILSFFPSTKLHAQTSVLAKRWRHLWTHHPNLHISMPYPGNDNTDDYTDIAANYVL 119 +LLH IL S + A+TSVL++RWR++W H P L GN D A+++ Sbjct: 10 ELLHDILLRLDSARAAARTSVLSRRWRYVWAHLPEL----VSDGNGTDSDSAAPPASFLD 65 Query: 118 SVDRCLRSFNSPSLHSFSIVFWLPTPRSRA 29 SVD LR++++P++ + I +P PR A Sbjct: 66 SVDGALRAYSAPAIEALDIS--VPGPRCPA 93