BLASTX nr result
ID: Anemarrhena21_contig00047441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00047441 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009388913.1| PREDICTED: lamin-like protein [Musa acuminat... 58 2e-06 >ref|XP_009388913.1| PREDICTED: lamin-like protein [Musa acuminata subsp. malaccensis] Length = 166 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 178 KYTVGDAQAWKPNVNYTKWVNKHKPFYVGDRL 273 ++TVGD Q W PNVNYT WV KHKPF+VGD L Sbjct: 25 RFTVGDRQGWNPNVNYTVWVEKHKPFHVGDWL 56