BLASTX nr result
ID: Anemarrhena21_contig00047417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00047417 (368 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008779530.1| PREDICTED: uncharacterized protein LOC103699... 47 2e-06 >ref|XP_008779530.1| PREDICTED: uncharacterized protein LOC103699270, partial [Phoenix dactylifera] Length = 1140 Score = 47.4 bits (111), Expect(3) = 2e-06 Identities = 19/40 (47%), Positives = 29/40 (72%) Frame = -1 Query: 329 RFAQAITILHKRQEFATIDDMVVRVHPERFLPGTLKKLHA 210 R+ A+ + + QEF DD+++R+ PERF PGT++KLHA Sbjct: 929 RYKMAVDLRRRYQEFRVGDDVMIRIRPERFPPGTVRKLHA 968 Score = 25.8 bits (55), Expect(3) = 2e-06 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 148 EFRINLVFNIEDLTLCRTLVAYPT 77 +F IN VFN+EDL R PT Sbjct: 992 DFGINPVFNVEDLVAYRGPTTIPT 1015 Score = 23.9 bits (50), Expect(3) = 2e-06 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 204 GPYRILRRFGFNA 166 GPY+IL+R G NA Sbjct: 972 GPYKILKRVGSNA 984