BLASTX nr result
ID: Anemarrhena21_contig00047202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00047202 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400569.1| PREDICTED: putative clathrin assembly protei... 58 2e-06 ref|XP_009408060.1| PREDICTED: putative clathrin assembly protei... 58 3e-06 ref|XP_008644118.1| PREDICTED: hypothetical protein isoform X1 [... 57 5e-06 ref|NP_001169970.1| hypothetical protein [Zea mays] gi|224032643... 57 5e-06 gb|AES92253.2| clathrin assembly plant-like protein [Medicago tr... 56 8e-06 ref|XP_003610056.1| Phosphoprotein-like protein [Medicago trunca... 56 8e-06 >ref|XP_009400569.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa acuminata subsp. malaccensis] Length = 585 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 17 GTWRKAYGALKDSTKVGLPKVNSEFKVRFLSIALVSFVSH 136 GTWRKAYGALKDSTKVGL KVNSEFK L IA+V +H Sbjct: 2 GTWRKAYGALKDSTKVGLAKVNSEFK--DLDIAIVKATNH 39 >ref|XP_009408060.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa acuminata subsp. malaccensis] Length = 570 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 17 GTWRKAYGALKDSTKVGLPKVNSEFKVRFLSIALVSFVSH 136 GTWRKAYGALKDSTKVGL KVNSEFK L +A+V +H Sbjct: 2 GTWRKAYGALKDSTKVGLAKVNSEFK--DLDVAIVKATNH 39 >ref|XP_008644118.1| PREDICTED: hypothetical protein isoform X1 [Zea mays] Length = 578 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 17 GTWRKAYGALKDSTKVGLPKVNSEFKVRFLSIALVSFVSH 136 G+WRKAYGALKDSTKVGL KVNSEFK L IA+V +H Sbjct: 2 GSWRKAYGALKDSTKVGLAKVNSEFKE--LDIAIVKATNH 39 >ref|NP_001169970.1| hypothetical protein [Zea mays] gi|224032643|gb|ACN35397.1| unknown [Zea mays] gi|413935798|gb|AFW70349.1| hypothetical protein ZEAMMB73_344011 [Zea mays] Length = 577 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 17 GTWRKAYGALKDSTKVGLPKVNSEFKVRFLSIALVSFVSH 136 G+WRKAYGALKDSTKVGL KVNSEFK L IA+V +H Sbjct: 2 GSWRKAYGALKDSTKVGLAKVNSEFKE--LDIAIVKATNH 39 >gb|AES92253.2| clathrin assembly plant-like protein [Medicago truncatula] Length = 579 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 20 TWRKAYGALKDSTKVGLPKVNSEFKVRFLSIALVSFVSH 136 TWRKAYGALKDSTKVGL KVNSE+K L IA+V SH Sbjct: 6 TWRKAYGALKDSTKVGLAKVNSEYKE--LDIAIVKATSH 42 >ref|XP_003610056.1| Phosphoprotein-like protein [Medicago truncatula] Length = 584 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 20 TWRKAYGALKDSTKVGLPKVNSEFKVRFLSIALVSFVSH 136 TWRKAYGALKDSTKVGL KVNSE+K L IA+V SH Sbjct: 6 TWRKAYGALKDSTKVGLAKVNSEYKE--LDIAIVKATSH 42