BLASTX nr result
ID: Anemarrhena21_contig00047016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00047016 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009108136.1| PREDICTED: potassium transporter 10 [Brassic... 73 8e-11 emb|CDY12441.1| BnaC08g09300D [Brassica napus] 73 8e-11 emb|CDY27164.1| BnaA08g08020D [Brassica napus] 73 8e-11 gb|KFK44899.1| hypothetical protein AALP_AA1G317400 [Arabis alpina] 73 8e-11 ref|XP_006415367.1| hypothetical protein EUTSA_v10006837mg [Eutr... 73 8e-11 ref|XP_009765361.1| PREDICTED: potassium transporter 11-like [Ni... 72 1e-10 ref|XP_009613821.1| PREDICTED: potassium transporter 11-like, pa... 72 1e-10 ref|XP_008663583.1| PREDICTED: probable potassium transporter 11... 72 1e-10 ref|XP_008663582.1| PREDICTED: probable potassium transporter 11... 72 1e-10 ref|XP_008668893.1| PREDICTED: probable potassium transporter 11... 72 1e-10 gb|AGT16607.1| potasium transporter [Saccharum hybrid cultivar R... 72 1e-10 emb|CBI27194.3| unnamed protein product [Vitis vinifera] 72 1e-10 ref|XP_004976796.1| PREDICTED: probable potassium transporter 11... 72 1e-10 ref|NP_001288551.1| probable potassium transporter 11 [Zea mays]... 72 1e-10 ref|XP_008650783.1| PREDICTED: uncharacterized protein LOC100191... 72 1e-10 gb|AFW59434.1| hypothetical protein ZEAMMB73_310046 [Zea mays] 72 1e-10 gb|ADM13642.1| putative potassium transporter [Nicotiana tabacum] 72 1e-10 ref|XP_002448524.1| hypothetical protein SORBIDRAFT_06g028380 [S... 72 1e-10 ref|XP_002276261.2| PREDICTED: potassium transporter 11 [Vitis v... 72 1e-10 ref|XP_009384154.1| PREDICTED: probable potassium transporter 11... 72 2e-10 >ref|XP_009108136.1| PREDICTED: potassium transporter 10 [Brassica rapa] Length = 793 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAKVNTIPNQHRTDEELTTYSR Sbjct: 125 GGTFALYSLLCRHAKVNTIPNQHRTDEELTTYSR 158 >emb|CDY12441.1| BnaC08g09300D [Brassica napus] Length = 794 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAKVNTIPNQHRTDEELTTYSR Sbjct: 125 GGTFALYSLLCRHAKVNTIPNQHRTDEELTTYSR 158 >emb|CDY27164.1| BnaA08g08020D [Brassica napus] Length = 757 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAKVNTIPNQHRTDEELTTYSR Sbjct: 125 GGTFALYSLLCRHAKVNTIPNQHRTDEELTTYSR 158 >gb|KFK44899.1| hypothetical protein AALP_AA1G317400 [Arabis alpina] Length = 798 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAKVNTIPNQHRTDEELTTYSR Sbjct: 124 GGTFALYSLLCRHAKVNTIPNQHRTDEELTTYSR 157 >ref|XP_006415367.1| hypothetical protein EUTSA_v10006837mg [Eutrema salsugineum] gi|557093138|gb|ESQ33720.1| hypothetical protein EUTSA_v10006837mg [Eutrema salsugineum] Length = 797 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAKVNTIPNQHRTDEELTTYSR Sbjct: 124 GGTFALYSLLCRHAKVNTIPNQHRTDEELTTYSR 157 >ref|XP_009765361.1| PREDICTED: potassium transporter 11-like [Nicotiana sylvestris] Length = 789 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 121 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 154 >ref|XP_009613821.1| PREDICTED: potassium transporter 11-like, partial [Nicotiana tomentosiformis] Length = 673 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 5 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 38 >ref|XP_008663583.1| PREDICTED: probable potassium transporter 11 isoform X2 [Zea mays] Length = 813 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 117 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 150 >ref|XP_008663582.1| PREDICTED: probable potassium transporter 11 isoform X1 [Zea mays] Length = 814 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 118 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 151 >ref|XP_008668893.1| PREDICTED: probable potassium transporter 11 isoform X2 [Zea mays] Length = 808 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 120 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 153 >gb|AGT16607.1| potasium transporter [Saccharum hybrid cultivar R570] Length = 804 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 118 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 151 >emb|CBI27194.3| unnamed protein product [Vitis vinifera] Length = 743 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 118 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 151 >ref|XP_004976796.1| PREDICTED: probable potassium transporter 11 [Setaria italica] Length = 804 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 116 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 149 >ref|NP_001288551.1| probable potassium transporter 11 [Zea mays] gi|670375119|ref|XP_008668892.1| PREDICTED: probable potassium transporter 11 isoform X1 [Zea mays] gi|414585469|tpg|DAA36040.1| TPA: hypothetical protein ZEAMMB73_467260 [Zea mays] gi|576866906|gb|AHH35050.1| high-affinity potassium transporter [Zea mays] Length = 809 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 121 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 154 >ref|XP_008650783.1| PREDICTED: uncharacterized protein LOC100191398 isoform X1 [Zea mays] gi|414884539|tpg|DAA60553.1| TPA: hypothetical protein ZEAMMB73_722863 [Zea mays] gi|576866922|gb|AHH35058.1| high-affinity potassium transporter [Zea mays] Length = 787 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 117 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 150 >gb|AFW59434.1| hypothetical protein ZEAMMB73_310046 [Zea mays] Length = 452 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 118 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 151 >gb|ADM13642.1| putative potassium transporter [Nicotiana tabacum] Length = 378 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 122 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 155 >ref|XP_002448524.1| hypothetical protein SORBIDRAFT_06g028380 [Sorghum bicolor] gi|241939707|gb|EES12852.1| hypothetical protein SORBIDRAFT_06g028380 [Sorghum bicolor] Length = 805 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 118 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 151 >ref|XP_002276261.2| PREDICTED: potassium transporter 11 [Vitis vinifera] gi|147778418|emb|CAN60810.1| hypothetical protein VITISV_036657 [Vitis vinifera] Length = 790 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAK+NTIPNQHRTDEELTTYSR Sbjct: 118 GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSR 151 >ref|XP_009384154.1| PREDICTED: probable potassium transporter 11 [Musa acuminata subsp. malaccensis] Length = 780 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 103 GGTFALYPLLCRHAKVNTIPNQHRTDEELTTYSR 2 GGTFALY LLCRHAKVNTIPNQHRTDE+LTTYSR Sbjct: 116 GGTFALYSLLCRHAKVNTIPNQHRTDEQLTTYSR 149