BLASTX nr result
ID: Anemarrhena21_contig00046640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00046640 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529689.1| conserved hypothetical protein [Ricinus comm... 64 4e-08 >ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis] gi|223530837|gb|EEF32700.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/87 (36%), Positives = 50/87 (57%) Frame = -2 Query: 265 GCFTPTEAEALVIQEALSWLKESRYDNFTLESDALQVVRGILKPCYVNLIGLCLDEVRCM 86 G +TP EAEA+ I+EALSWLK+ ++ +ESDALQV+ + P + L +D+ + + Sbjct: 11 GNYTPREAEAISIREALSWLKQQIFEECIIESDALQVIEALKAPSSQSCFHLIIDDCKHL 70 Query: 85 LNHFNQXXXXXXXXXXXSAAHLCAKAA 5 + HF Q +AA + A+ A Sbjct: 71 VQHFRQVHFQFVRRSANTAAQIVARGA 97