BLASTX nr result
ID: Anemarrhena21_contig00046543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00046543 (262 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009383035.1| PREDICTED: pentatricopeptide repeat-containi... 47 6e-08 >ref|XP_009383035.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 550 Score = 47.0 bits (110), Expect(2) = 6e-08 Identities = 25/56 (44%), Positives = 35/56 (62%) Frame = -3 Query: 173 GFAWNGRVDVALLVFSQMLDGCMRLDNLMFLPMLFVWAHS*VTEQGLPHFKMMSSE 6 GF NGR + AL F +ML + +++ F+ +L AHS + E+ L HFKMMSSE Sbjct: 334 GFGSNGRGEEALGFFKRMLQEGTKPNDITFIGILVACAHSGLVEEALHHFKMMSSE 389 Score = 36.2 bits (82), Expect(2) = 6e-08 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -1 Query: 259 HVSTALANY*CKSGLLDLALNLYVRL*EKD 170 HVS AL N+ CK GLLD A ++ R EKD Sbjct: 295 HVSNALVNFYCKCGLLDAAAKVFERTMEKD 324