BLASTX nr result
ID: Anemarrhena21_contig00046192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00046192 (407 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63154.1| hypothetical protein 20.t00006 [Asparagus officin... 75 1e-11 gb|ABD63171.1| hypothetical protein 20.t00023 [Asparagus officin... 58 2e-06 >gb|ABD63154.1| hypothetical protein 20.t00006 [Asparagus officinalis] Length = 851 Score = 75.5 bits (184), Expect = 1e-11 Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 2/105 (1%) Frame = +3 Query: 90 LRSGEAAKKIDQGLAPVTLDSGEVMWVHPNLLNDEQWTTVRSKNDSKGRRKSCDVV--SM 263 L++ + + D+GL P+T GE+MWVHP+LL D+QWT+ SK G+ KS +++ S+ Sbjct: 726 LKNVDPHSQKDRGLVPLTTQKGEIMWVHPDLLRDQQWTSTSSKKKG-GKAKSSNMISPSI 784 Query: 264 TTKDQTLTFYLADSEGEEEALAVQSSAPQPAGTKSGQSYLKQYDQ 398 T D L L DS EEE +A+ + GT+SG++YL+ Y Q Sbjct: 785 TENDDHLK-PLTDS--EEERIALAAYPGDNPGTRSGKTYLRDYGQ 826 >gb|ABD63171.1| hypothetical protein 20.t00023 [Asparagus officinalis] Length = 403 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%) Frame = +3 Query: 120 DQGLAPVTLDSGEVMWVHPNLLNDEQWTTVRSKNDSKGRRKSCDVVS-MTTKDQTLTFYL 296 ++GL TL SG+VMWVHP+LL+D+QWT SK+ K + K +V+S + D+ L Sbjct: 177 EKGLVSQTLPSGQVMWVHPDLLSDKQWT---SKSSGKPKGKPYNVISAIPDGDKAEMTTL 233 Query: 297 ADSEGEEEALAVQSS 341 DS+ E ++LA ++S Sbjct: 234 TDSKDEADSLATRAS 248