BLASTX nr result
ID: Anemarrhena21_contig00046098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00046098 (359 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CJL31330.1| Uncharacterised protein [Streptococcus pneumoniae] 57 4e-06 ref|WP_022187435.1| hypothetical protein [Azospirillum sp. CAG:2... 57 4e-06 gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propioniba... 57 5e-06 >emb|CJL31330.1| Uncharacterised protein [Streptococcus pneumoniae] Length = 85 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +3 Query: 69 PDKRSLQSRGPSSSTRHGWFRLASIDQYSLLLPPVGVGPVSQCPCD 206 P+ + R PSS TRHGW RL+ I QYS LLPPVGV VSQ CD Sbjct: 40 PNLKCFTIRRPSSHTRHGWIRLSPIVQYSPLLPPVGVWTVSQFQCD 85 >ref|WP_022187435.1| hypothetical protein [Azospirillum sp. CAG:260] gi|524390510|emb|CDB39267.1| putative uncharacterized protein [Azospirillum sp. CAG:260] Length = 146 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = +3 Query: 75 KRSLQSRGPSSSTRHGWFRLASIDQYSLLLPPVGVGPVSQCPC 203 ++S R PSS TRHGW R+ASI QYS LLPPVGV VSQ C Sbjct: 103 RKSFTIRKPSSLTRHGWVRVASIAQYSSLLPPVGVWTVSQFQC 145 >gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] Length = 113 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/57 (49%), Positives = 32/57 (56%) Frame = +1 Query: 1 WHGVSRCLFIWYRQPQKNSRVSSQIKEVYNPEDLHPPRGMAGSDLRPLTNIPYCCLP 171 WH VSRC F YR + + S PE HP RG+A S RPL NIP+CCLP Sbjct: 62 WHVVSRCFFTHYRHSRFVTGESG-----LQPEGRHPARGVAASGFRPLCNIPHCCLP 113