BLASTX nr result
ID: Anemarrhena21_contig00046086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00046086 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16105.1| unnamed protein product [Coffea canephora] 56 8e-06 >emb|CDP16105.1| unnamed protein product [Coffea canephora] Length = 123 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 236 RRLVKAATAADSSGGVTSSFSFITPSSAVFQV 141 R+LV+AATAADS+GGV SSFSFITPSSAVFQV Sbjct: 36 RKLVQAATAADSAGGVQSSFSFITPSSAVFQV 67