BLASTX nr result
ID: Anemarrhena21_contig00045525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00045525 (459 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008781618.1| PREDICTED: RNA polymerase II transcriptional... 45 3e-09 ref|XP_010930695.1| PREDICTED: RNA polymerase II transcriptional... 47 7e-09 >ref|XP_008781618.1| PREDICTED: RNA polymerase II transcriptional coactivator KIWI-like [Phoenix dactylifera] Length = 103 Score = 45.1 bits (105), Expect(2) = 3e-09 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = -1 Query: 324 VISGLSKSRRVSVRKWQGKISVDIIKFYVKVWERASRGKKKVS 196 V+ +SK+RRVSVR WQGK+ VDI +FY+K ++ G+K +S Sbjct: 38 VVCEISKNRRVSVRSWQGKVVVDIREFYIKDGKQLP-GRKGIS 79 Score = 42.7 bits (99), Expect(2) = 3e-09 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -3 Query: 433 MWRIGKKRTGEESAAGDSDGVPPMK 359 MW+ GKKR EESA GDSDG PP K Sbjct: 1 MWKKGKKRNDEESAGGDSDGAPPSK 25 >ref|XP_010930695.1| PREDICTED: RNA polymerase II transcriptional coactivator KIWI-like [Elaeis guineensis] Length = 103 Score = 47.4 bits (111), Expect(2) = 7e-09 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = -1 Query: 354 SMAFPTTSHFVISGLSKSRRVSVRKWQGKISVDIIKFYVKVWERASRGKKKVS 196 +MA V+ +SK+RRVSVR WQGK+ VDI +FYVK ++ GKK +S Sbjct: 28 AMAESDEDGIVVCEISKNRRVSVRSWQGKVVVDIREFYVKDGKQLP-GKKGIS 79 Score = 39.3 bits (90), Expect(2) = 7e-09 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -3 Query: 433 MWRIGKKRTGEESAAGDSDGVPPMK 359 MWR GKKR EESA G DG PP K Sbjct: 1 MWRKGKKRNDEESAGGSFDGAPPSK 25