BLASTX nr result
ID: Anemarrhena21_contig00045363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00045363 (318 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008792153.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-10 ref|XP_010915122.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-10 ref|XP_010272254.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-08 ref|XP_010272256.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-08 ref|XP_009415688.1| PREDICTED: pentatricopeptide repeat-containi... 53 4e-08 ref|XP_009387668.1| PREDICTED: pentatricopeptide repeat-containi... 53 4e-08 dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens] 59 8e-08 ref|XP_001780298.1| predicted protein [Physcomitrella patens] gi... 59 8e-08 ref|XP_004307165.2| PREDICTED: pentatricopeptide repeat-containi... 58 4e-07 ref|XP_011624784.1| PREDICTED: pentatricopeptide repeat-containi... 54 5e-07 ref|XP_010909928.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-07 ref|XP_008340993.1| PREDICTED: pentatricopeptide repeat-containi... 47 8e-07 ref|XP_011623535.1| PREDICTED: pentatricopeptide repeat-containi... 53 8e-07 ref|XP_011626963.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 gb|AEB39779.1| pentatricopeptide repeat protein 98 [Funaria hygr... 55 1e-06 ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containi... 53 1e-06 ref|XP_008463019.1| PREDICTED: pentatricopeptide repeat-containi... 54 1e-06 ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containi... 54 1e-06 emb|CAN78152.1| hypothetical protein VITISV_040250 [Vitis vinifera] 53 1e-06 ref|XP_008218943.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-06 >ref|XP_008792153.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Phoenix dactylifera] Length = 729 Score = 61.6 bits (148), Expect(2) = 2e-10 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 256 GCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 GCMVDLF +A LL EA FI+ GY+ D VWGALLGAC+IH + Sbjct: 612 GCMVDLFGRAGLLKEAADFIVSLGYEADANVWGALLGACRIHGNV 656 Score = 30.4 bits (67), Expect(2) = 2e-10 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQWTVKK 9 EL+ H+ A V SN+Y E+GQW K Sbjct: 668 ELDPLHDGAHVLMSNLYAESGQWNEAK 694 >ref|XP_010915122.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Elaeis guineensis] Length = 730 Score = 60.1 bits (144), Expect(2) = 3e-10 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -3 Query: 256 GCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 GCMVDLF +A LL EA FI GY+ D VWGALLGAC+IH + Sbjct: 613 GCMVDLFGRAGLLKEAADFITSLGYEVDAHVWGALLGACRIHGNV 657 Score = 30.8 bits (68), Expect(2) = 3e-10 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQWTVKK 9 EL+ H+ A V SN+Y E+GQW K Sbjct: 669 ELDPLHDGARVLMSNLYAESGQWNEAK 695 >ref|XP_010272254.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like isoform X1 [Nelumbo nucifera] gi|720051949|ref|XP_010272255.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like isoform X1 [Nelumbo nucifera] Length = 946 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = -3 Query: 271 SNCAFGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 S C + CMVDL +A L EA FI C + D+ +WGALLGACKIH+ + Sbjct: 710 SLCHYSCMVDLLGRAGCLYEAEAFIECMPIEPDSVIWGALLGACKIHQNV 759 Score = 26.9 bits (58), Expect(2) = 4e-08 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 98 RWCELESRHESALVHTSNIYPEAGQWTVKKE 6 R +LE ++ S + SNIY G WT +E Sbjct: 768 RLFQLEPQNSSTYILLSNIYASLGMWTEVEE 798 >ref|XP_010272256.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like isoform X2 [Nelumbo nucifera] Length = 922 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = -3 Query: 271 SNCAFGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 S C + CMVDL +A L EA FI C + D+ +WGALLGACKIH+ + Sbjct: 686 SLCHYSCMVDLLGRAGCLYEAEAFIECMPIEPDSVIWGALLGACKIHQNV 735 Score = 26.9 bits (58), Expect(2) = 4e-08 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 98 RWCELESRHESALVHTSNIYPEAGQWTVKKE 6 R +LE ++ S + SNIY G WT +E Sbjct: 744 RLFQLEPQNSSTYILLSNIYASLGMWTEVEE 774 >ref|XP_009415688.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Musa acuminata subsp. malaccensis] Length = 655 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 28/62 (45%), Positives = 38/62 (61%) Frame = -3 Query: 316 RRTDRNMIKRLQDGTSNCAFGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACK 137 RR +MI+ + + +GCMVDL +A LL EAL FI + + VWG+LLGAC+ Sbjct: 404 RRIFESMIQDYRLEPKHEHYGCMVDLLGRARLLQEALEFIESMPFAPNVVVWGSLLGACR 463 Query: 136 IH 131 IH Sbjct: 464 IH 465 Score = 31.2 bits (69), Expect(2) = 4e-08 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 110 LQQRRWCELESRHESALVHTSNIYPEAGQWTVKKE 6 L RR EL+ H+ A V SNIY +A +W +E Sbjct: 473 LVARRLLELDPNHDGAYVLLSNIYAKASRWEDVRE 507 >ref|XP_009387668.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Musa acuminata subsp. malaccensis] Length = 653 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 28/62 (45%), Positives = 38/62 (61%) Frame = -3 Query: 316 RRTDRNMIKRLQDGTSNCAFGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACK 137 RR +MI+ + + +GCMVDL +A LL EAL FI + + VWG+LLGAC+ Sbjct: 402 RRIFESMIQDYRLEPKHEHYGCMVDLLGRARLLQEALEFIESMPFAPNVVVWGSLLGACR 461 Query: 136 IH 131 IH Sbjct: 462 IH 463 Score = 31.2 bits (69), Expect(2) = 4e-08 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 110 LQQRRWCELESRHESALVHTSNIYPEAGQWTVKKE 6 L RR EL+ H+ A V SNIY +A +W +E Sbjct: 471 LVARRLLELDPNHDGAYVLLSNIYAKASRWEDVRE 505 >dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens] Length = 986 Score = 59.3 bits (142), Expect(2) = 8e-08 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 +GCMVDLF +A LL EA+ FI+ + D++VWGALLGAC++H + Sbjct: 754 YGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVHLNV 799 Score = 23.5 bits (49), Expect(2) = 8e-08 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQW 21 EL+ V SNIY AG W Sbjct: 811 ELDPNDNGVFVILSNIYAAAGMW 833 >ref|XP_001780298.1| predicted protein [Physcomitrella patens] gi|162668246|gb|EDQ54857.1| predicted protein [Physcomitrella patens] Length = 986 Score = 59.3 bits (142), Expect(2) = 8e-08 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 +GCMVDLF +A LL EA+ FI+ + D++VWGALLGAC++H + Sbjct: 754 YGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVHLNV 799 Score = 23.5 bits (49), Expect(2) = 8e-08 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQW 21 EL+ V SNIY AG W Sbjct: 811 ELDPNDNGVFVILSNIYAAAGMW 833 >ref|XP_004307165.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 608 Score = 57.8 bits (138), Expect(2) = 4e-07 Identities = 28/62 (45%), Positives = 41/62 (66%) Frame = -3 Query: 307 DRNMIKRLQDGTSNCAFGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHR 128 D + + +L+ T + +GCMVDL +A L+GEA+ F+ + D VWGALLGAC+IH Sbjct: 445 DMSTVYKLRPQTEH--YGCMVDLLGRAGLIGEAVEFVNNMPIEPDAFVWGALLGACRIHG 502 Query: 127 KI 122 K+ Sbjct: 503 KV 504 Score = 22.7 bits (47), Expect(2) = 4e-07 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQW 21 ++E + A V SNIY A +W Sbjct: 516 KVEPERDGAYVLMSNIYSSANKW 538 >ref|XP_011624784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 649 Score = 53.5 bits (127), Expect(2) = 5e-07 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIH 131 +GCMVDL +A LL EAL FI C + +WGAL+GACKIH Sbjct: 417 YGCMVDLLGRAGLLKEALRFIDCMPIKPHPGLWGALVGACKIH 459 Score = 26.6 bits (57), Expect(2) = 5e-07 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 101 RRWCELESRHESALVHTSNIYPEAGQW 21 +R ELE H V SNIY A +W Sbjct: 470 KRLIELEPHHSGRYVILSNIYASARKW 496 >ref|XP_010909928.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like [Elaeis guineensis] Length = 806 Score = 55.1 bits (131), Expect(2) = 6e-07 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 + CMVDL +A LL EA+ FI ++ D+ VWGALLGAC++H K+ Sbjct: 675 YACMVDLLGRAGLLEEAVEFIRGMPFEPDSNVWGALLGACRVHGKL 720 Score = 24.6 bits (52), Expect(2) = 6e-07 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = -2 Query: 113 RLQQRRWC-----ELESRHESALVHTSNIYPEAGQWTVKKE 6 +L+ RW +L+ H + SN+Y EAG+W E Sbjct: 719 KLELGRWAAEHLFKLKPGHCGYYILLSNMYAEAGRWDEANE 759 >ref|XP_008340993.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 [Malus domestica] Length = 728 Score = 47.4 bits (111), Expect(2) = 8e-07 Identities = 24/62 (38%), Positives = 34/62 (54%) Frame = -3 Query: 316 RRTDRNMIKRLQDGTSNCAFGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACK 137 RR +MI + +GCMVDLF +A LL EAL I + + +W +L+ AC+ Sbjct: 477 RRVFESMIDEYNITPKHEHYGCMVDLFGRAGLLREALEVIEAMPFAPNVVIWSSLMAACQ 536 Query: 136 IH 131 IH Sbjct: 537 IH 538 Score = 32.0 bits (71), Expect(2) = 8e-07 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 101 RRWCELESRHESALVHTSNIYPEAGQW 21 R+ ELE H+ ALV SNIY + G+W Sbjct: 549 RQLLELEPDHDGALVALSNIYAKQGRW 575 >ref|XP_011623535.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Amborella trichopoda] Length = 680 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 24/46 (52%), Positives = 30/46 (65%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 +GCMVDL +A LL +A I + D VWGALLGACKIH+ + Sbjct: 447 YGCMVDLLGRAGLLDQAYALIKSMAMKPDFVVWGALLGACKIHKNV 492 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 110 LQQRRWCELESRHESALVHTSNIYPEAGQW 21 + ++ EL+ ++ V SNIY EAG+W Sbjct: 497 ISAKKLFELDPKNTGYYVLLSNIYSEAGRW 526 >ref|XP_011626963.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Amborella trichopoda] Length = 537 Score = 57.4 bits (137), Expect(2) = 1e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -3 Query: 256 GCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 GCMVDL+ +A L+GEAL FI G + VWGALLGAC+IH I Sbjct: 383 GCMVDLYGRAGLIGEALRFIREMGVKPGDSVWGALLGACRIHGNI 427 Score = 21.6 bits (44), Expect(2) = 1e-06 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQW 21 EL + A + +NIY AG+W Sbjct: 439 ELMPENPVAYICLANIYAAAGRW 461 >gb|AEB39779.1| pentatricopeptide repeat protein 98 [Funaria hygrometrica] Length = 980 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIH 131 +GCMVDLF +A LL EA+ FI + D+++WGALLGAC++H Sbjct: 748 YGCMVDLFGRAGLLHEAVEFINKMQVKPDSRLWGALLGACQVH 790 Score = 23.9 bits (50), Expect(2) = 1e-06 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQW 21 EL+ + V SNIY AG W Sbjct: 805 ELDPNDDGVYVILSNIYAAAGMW 827 >ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 632 Score = 52.8 bits (125), Expect(2) = 1e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 +GCMVDL +A LL EA FIL + + VWGALLGAC++H+ + Sbjct: 400 YGCMVDLLSRAGLLHEAHEFILNMPMKPNGVVWGALLGACRVHKNV 445 Score = 25.8 bits (55), Expect(2) = 1e-06 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQW 21 EL+ ++ V SNIY EAG+W Sbjct: 457 ELDPLNDGYYVVLSNIYAEAGRW 479 >ref|XP_008463019.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis melo] Length = 623 Score = 53.5 bits (127), Expect(2) = 1e-06 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 +GCMVDLF +A LL EA FI+ + VWGALLG CK+H+ I Sbjct: 391 YGCMVDLFSRAGLLQEAHEFIMNMPIAPNGVVWGALLGGCKVHKNI 436 Score = 25.0 bits (53), Expect(2) = 1e-06 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 101 RRWCELESRHESALVHTSNIYPEAGQW 21 R +L+ ++ V SNIY EAG+W Sbjct: 444 RHLSKLDPLNDGYYVVLSNIYAEAGRW 470 >ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] gi|700189158|gb|KGN44391.1| hypothetical protein Csa_7G279250 [Cucumis sativus] Length = 617 Score = 53.5 bits (127), Expect(2) = 1e-06 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 +GCMVDLF +A LL EA FI+ + VWGALLG CK+H+ I Sbjct: 385 YGCMVDLFSRAGLLQEAHEFIMNMPIAPNGVVWGALLGGCKVHKNI 430 Score = 25.0 bits (53), Expect(2) = 1e-06 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 101 RRWCELESRHESALVHTSNIYPEAGQW 21 R +L+ ++ V SNIY EAG+W Sbjct: 438 RHLSKLDPLNDGYYVVLSNIYAEAGRW 464 >emb|CAN78152.1| hypothetical protein VITISV_040250 [Vitis vinifera] Length = 606 Score = 52.8 bits (125), Expect(2) = 1e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = -3 Query: 259 FGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHRKI 122 +GCMVDL +A LL EA FIL + + VWGALLGAC++H+ + Sbjct: 400 YGCMVDLLSRAGLLHEAHEFILNMPMKPNGVVWGALLGACRVHKNV 445 Score = 25.8 bits (55), Expect(2) = 1e-06 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 89 ELESRHESALVHTSNIYPEAGQW 21 EL+ ++ V SNIY EAG+W Sbjct: 457 ELDPLNDGYYVVLSNIYAEAGRW 479 >ref|XP_008218943.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Prunus mume] Length = 602 Score = 55.5 bits (132), Expect(2) = 1e-06 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = -3 Query: 307 DRNMIKRLQDGTSNCAFGCMVDLFRKADLLGEALYFILCSGYQDDTKVWGALLGACKIHR 128 D + + RL+ T + +GCMVDL +A L+ EA F+ + D VWGALLGAC+IH Sbjct: 444 DMSSVYRLRPQTEH--YGCMVDLLGRAGLINEAEEFVKNMPIEPDAFVWGALLGACRIHG 501 Query: 127 KI 122 K+ Sbjct: 502 KV 503 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 101 RRWCELESRHESALVHTSNIYPEAGQW 21 ++ ++E + A V SNIY A +W Sbjct: 511 KKLLKVEPERDGAYVLMSNIYSSANRW 537