BLASTX nr result
ID: Anemarrhena21_contig00045195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00045195 (527 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGI48779.1| cytochrome c biogenesis B (mitochondrion) [Lolium... 79 2e-12 ref|YP_002000599.1| cytochrome c biogenesis B (mitochondrion) [O... 66 1e-08 gb|AAC64369.1| ABC transporter CcbB (mitochondrion) [Triticum ae... 66 1e-08 ref|YP_008802498.1| cytochrome c biogenesis B (mitochondrion) (m... 64 4e-08 pir||S78218 probable heme transport protein - evening primrose m... 64 4e-08 dbj|BAD83549.2| cytochrome c maturation protein CcmB (mitochondr... 64 4e-08 emb|CAJ77656.1| cytochrome c biogenesis protein [Isophysis tasma... 64 4e-08 emb|CAJ77659.1| cytochrome c biogenesis protein [Amaryllis sp. Q... 63 7e-08 gb|AKJ25482.1| cytochrome c maturase subunit B (mitochondrion) [... 61 3e-07 gb|AKJ25468.1| cytochrome c maturase subunit B (mitochondrion) [... 61 3e-07 gb|AKJ25466.1| cytochrome c maturase subunit B (mitochondrion) [... 61 3e-07 gb|AKJ25464.1| cytochrome c maturase subunit B (mitochondrion) [... 61 3e-07 gb|AKJ25463.1| cytochrome c maturase subunit B (mitochondrion) [... 61 3e-07 gb|ABB02055.1| ccb206 [Brassica oleracea] 61 3e-07 emb|CAJ77657.1| cytochrome c biogenesis protein [Narcissus pseud... 61 3e-07 emb|CAJ77658.1| cytochrome c biogenesis protein [Yucca sp. Quagl... 60 4e-07 ref|NP_064031.2| ccb206 gene product (mitochondrion) [Beta vulga... 60 6e-07 ref|YP_003587369.1| cytochrome c biogenesis B [Cucurbita pepo] g... 60 7e-07 ref|YP_008992402.1| cytochrome c biogenesis B (mitochondrion) [S... 60 7e-07 ref|YP_398411.1| ccmB (mitochondrion) [Triticum aestivum] gi|556... 60 7e-07 >gb|AGI48779.1| cytochrome c biogenesis B (mitochondrion) [Lolium perenne] Length = 216 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 132 MNSKERRSKEMRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MNSKERRSKEMRRLFLE F+KQIF STPITSFFLFL YIVVTP Sbjct: 1 MNSKERRSKEMRRLFLEQFHKQIFPSTPITSFFLFLSYIVVTP 43 >ref|YP_002000599.1| cytochrome c biogenesis B (mitochondrion) [Oryza sativa Japonica Group] gi|60498754|dbj|BAC19903.2| Cytochrome c biogenesis B (mitochondrion) [Oryza sativa Japonica Group] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLE FYKQIFSSTPITSFFLFLLYIVVTP Sbjct: 1 MRRLFLEQFYKQIFSSTPITSFFLFLLYIVVTP 33 >gb|AAC64369.1| ABC transporter CcbB (mitochondrion) [Triticum aestivum] gi|3435250|gb|AAC32374.1| ABC transporter CcbB (mitochondrion) [Triticum aestivum] Length = 206 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLE FYKQIFSSTPITSFFLFLLYIVVTP Sbjct: 1 MRRLFLEQFYKQIFSSTPITSFFLFLLYIVVTP 33 >ref|YP_008802498.1| cytochrome c biogenesis B (mitochondrion) (mitochondrion) [Asclepias syriaca] gi|556562337|gb|AGZ63033.1| cytochrome c biogenesis B (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 206 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRLFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >pir||S78218 probable heme transport protein - evening primrose mitochondrion (mitochondrion) [Oenothera villaricae] Length = 206 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRLFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >dbj|BAD83549.2| cytochrome c maturation protein CcmB (mitochondrion) [Nicotiana tabacum] Length = 206 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRLFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >emb|CAJ77656.1| cytochrome c biogenesis protein [Isophysis tasmanica] Length = 206 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLELFYKQIF STPITSFFLFL YIVVTP Sbjct: 1 MRRLFLELFYKQIFPSTPITSFFLFLSYIVVTP 33 >emb|CAJ77659.1| cytochrome c biogenesis protein [Amaryllis sp. Quagliariello 16108] Length = 206 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLELFYKQI STPITSFFLFLLYIVVTP Sbjct: 1 MRRLFLELFYKQICPSTPITSFFLFLLYIVVTP 33 >gb|AKJ25482.1| cytochrome c maturase subunit B (mitochondrion) [Monsonia emarginata] Length = 206 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRR FLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRPFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >gb|AKJ25468.1| cytochrome c maturase subunit B (mitochondrion) [Geranium macrorrhizum] Length = 206 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRR FLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRPFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >gb|AKJ25466.1| cytochrome c maturase subunit B (mitochondrion) [Geranium endressii] gi|825715932|gb|AKJ25470.1| cytochrome c maturase subunit B (mitochondrion) [Geranium nodosum] gi|825715934|gb|AKJ25471.1| cytochrome c maturase subunit B (mitochondrion) [Geranium platyanthum] gi|825715938|gb|AKJ25473.1| cytochrome c maturase subunit B (mitochondrion) [Geranium pratense] gi|825715940|gb|AKJ25474.1| cytochrome c maturase subunit B (mitochondrion) [Geranium platypetalum] gi|825715944|gb|AKJ25476.1| cytochrome c maturase subunit B (mitochondrion) [Geranium renardii] gi|825715948|gb|AKJ25478.1| cytochrome c maturase subunit B (mitochondrion) [Geranium subcaulescens] gi|825715950|gb|AKJ25479.1| cytochrome c maturase subunit B (mitochondrion) [Geranium sanguineum] Length = 206 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRR FLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRPFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >gb|AKJ25464.1| cytochrome c maturase subunit B (mitochondrion) [Erodium texanum] Length = 206 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRR FLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRPFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >gb|AKJ25463.1| cytochrome c maturase subunit B (mitochondrion) [California macrophylla] Length = 206 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRR FLEL+YKQIFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRPFLELYYKQIFSSTPITSFSLFLLYIVVTP 33 >gb|ABB02055.1| ccb206 [Brassica oleracea] Length = 205 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLEL+YK IFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRLFLELYYKLIFSSTPITSFSLFLLYIVVTP 33 >emb|CAJ77657.1| cytochrome c biogenesis protein [Narcissus pseudonarcissus] Length = 206 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLE FYKQI STPITSFFLFLLYIVVTP Sbjct: 1 MRRLFLERFYKQICPSTPITSFFLFLLYIVVTP 33 >emb|CAJ77658.1| cytochrome c biogenesis protein [Yucca sp. Quagliariello 16107] Length = 206 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFL+LF+KQIF STPITSFFLFL YIVVTP Sbjct: 1 MRRLFLKLFHKQIFPSTPITSFFLFLSYIVVTP 33 >ref|NP_064031.2| ccb206 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435056|ref|YP_004222274.1| cytochrome c maturation protein CcmB [Beta vulgaris subsp. maritima] gi|346683149|ref|YP_004842081.1| cytochrome c maturation protein CcmB [Beta macrocarpa] gi|87248017|gb|ABD36061.1| cytochrome c biogenesis B (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|148491420|dbj|BAA99342.2| cytochrome c biogenesis protein (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905709|emb|CBJ14097.1| cytochrome c biogenesis [Beta vulgaris subsp. maritima] gi|319439789|emb|CBJ17506.1| cytochrome c maturation protein CcmB [Beta vulgaris subsp. maritima] gi|320148724|emb|CBJ23362.1| cytochrome c maturation protein CcmB [Beta vulgaris subsp. maritima] gi|345500067|emb|CBX24883.1| cytochrome c maturation protein CcmB [Beta macrocarpa] gi|384939201|emb|CBL52048.1| cytochrome c maturation protein CcmB (mitochondrion) [Beta vulgaris subsp. maritima] Length = 206 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLF EL+YKQIF STPITSF LFLLYIVVTP Sbjct: 1 MRRLFFELYYKQIFFSTPITSFSLFLLYIVVTP 33 >ref|YP_003587369.1| cytochrome c biogenesis B [Cucurbita pepo] gi|259156806|gb|ACV96667.1| cytochrome c biogenesis B [Cucurbita pepo] Length = 206 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFL LF+K+IFSSTPITSF LFLLYIVVTP Sbjct: 1 MRRLFLSLFHKRIFSSTPITSFSLFLLYIVVTP 33 >ref|YP_008992402.1| cytochrome c biogenesis B (mitochondrion) [Salvia miltiorrhiza] gi|534292371|gb|AGU16663.1| cytochrome c biogenesis B (mitochondrion) [Salvia miltiorrhiza] Length = 206 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLEL++KQIFSSTPITSF LFL YIVVTP Sbjct: 1 MRRLFLELYHKQIFSSTPITSFSLFLSYIVVTP 33 >ref|YP_398411.1| ccmB (mitochondrion) [Triticum aestivum] gi|556927025|ref|YP_008757381.1| cytochrome c biogenesis protein ccmB (mitochondrion) [Aegilops speltoides] gi|556927198|ref|YP_008758156.1| cytochrome c biogenesis protein ccmB (mitochondrion) [Triticum timopheevii] gi|78675250|dbj|BAE47675.1| ccmB (mitochondrion) [Triticum aestivum] gi|164422241|gb|ABY55214.1| CcmB (mitochondrion) [Bambusa oldhamii] gi|169649061|gb|ACA62622.1| ccmB (mitochondrion) [Triticum aestivum] gi|291498613|gb|ADE08087.1| ccmB (mitochondrion) [Triticum aestivum] gi|372861920|gb|AEX98074.1| cytochrome c biogenesis B (mitochondrion) [Ferrocalamus rimosivaginus] gi|549067745|dbj|BAN94717.1| cytochrome c biogenesis protein ccmB (mitochondrion) [Triticum timopheevii] gi|549067789|dbj|BAN94760.1| cytochrome c biogenesis protein ccmB (mitochondrion) [Aegilops speltoides] gi|578888243|gb|AHI16348.1| ccmB (mitochondrion) [Aegilops longissima] gi|578888270|gb|AHI16374.1| ccmB (mitochondrion) [Triticum turgidum subsp. durum] Length = 206 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 102 MRRLFLELFYKQIFSSTPITSFFLFLLYIVVTP 4 MRRLFLE F+KQIF STPITSFFLFL YIVVTP Sbjct: 1 MRRLFLEQFHKQIFPSTPITSFFLFLSYIVVTP 33