BLASTX nr result
ID: Anemarrhena21_contig00045108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00045108 (339 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255177.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_010909359.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_009409010.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_010255177.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nelumbo nucifera] Length = 564 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/73 (38%), Positives = 45/73 (61%) Frame = -3 Query: 337 EVEMGISLLEEMVGKKFKVGVDLYSRVVRGLHKCGRVEESRKWLNQMIGGGILVSYDGWE 158 E+ + + +EM+ KK V +Y ++RGL CGR+EE+ +LN+MI G LVSY W+ Sbjct: 487 ELTNALLVFDEMLEKKIPVNGTIYEVILRGLCTCGRIEEAHMYLNKMIENGHLVSYSRWK 546 Query: 157 SLYDSIIMEGDRE 119 L DS+ + + + Sbjct: 547 VLLDSVFVGNEND 559 >ref|XP_010909359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like [Elaeis guineensis] Length = 539 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/66 (45%), Positives = 40/66 (60%) Frame = -3 Query: 322 ISLLEEMVGKKFKVGVDLYSRVVRGLHKCGRVEESRKWLNQMIGGGILVSYDGWESLYDS 143 ISLLE+M +K V L S V H G+ EE +LN+MI GILVSY WESL++S Sbjct: 467 ISLLEDMAREKMPVNFSLCSAVALSFHAQGKFEELNSYLNKMIENGILVSYAAWESLFES 526 Query: 142 IIMEGD 125 + + + Sbjct: 527 VTIRNE 532 >ref|XP_009409010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like [Musa acuminata subsp. malaccensis] Length = 580 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/68 (38%), Positives = 44/68 (64%) Frame = -3 Query: 337 EVEMGISLLEEMVGKKFKVGVDLYSRVVRGLHKCGRVEESRKWLNQMIGGGILVSYDGWE 158 + M +S +E+M +K +V V L++ VVR L+ G++EE+ ++N+MI G +VSY WE Sbjct: 496 DTAMAVSFVEQMEREKMQVDVGLHTSVVRSLYTTGKLEETHHYMNKMIESGTIVSYAEWE 555 Query: 157 SLYDSIIM 134 +S+ M Sbjct: 556 EFVNSMTM 563